2024-05-03 14:07:03, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001398656 1314 bp mRNA linear ROD 24-SEP-2023 DEFINITION Rattus norvegicus cyclin-dependent kinase 7 (Cdk7), transcript variant 1, mRNA. ACCESSION NM_001398656 XM_039103488 VERSION NM_001398656.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1314) AUTHORS Jeronimo C, Bataille AR and Robert F. TITLE The writers, readers, and functions of the RNA polymerase II C-terminal domain code JOURNAL Chem Rev 113 (11), 8491-8522 (2013) PUBMED 23837720 REMARK Review article REFERENCE 2 (bases 1 to 1314) AUTHORS Wang Y, Liu F, Mao F, Hang Q, Huang X, He S, Wang Y, Cheng C, Wang H, Xu G, Zhang T and Shen A. TITLE Interaction with cyclin H/cyclin-dependent kinase 7 (CCNH/CDK7) stabilizes C-terminal binding protein 2 (CtBP2) and promotes cancer cell migration JOURNAL J Biol Chem 288 (13), 9028-9034 (2013) PUBMED 23393140 REFERENCE 3 (bases 1 to 1314) AUTHORS Egloff S, Dienstbier M and Murphy S. TITLE Updating the RNA polymerase CTD code: adding gene-specific layers JOURNAL Trends Genet 28 (7), 333-341 (2012) PUBMED 22622228 REMARK Review article REFERENCE 4 (bases 1 to 1314) AUTHORS Fujii W, Nishimura T, Kano K, Sugiura K and Naito K. TITLE CDK7 and CCNH are components of CDK-activating kinase and are required for meiotic progression of pig oocytes JOURNAL Biol Reprod 85 (6), 1124-1132 (2011) PUBMED 21778139 REFERENCE 5 (bases 1 to 1314) AUTHORS Egly JM and Coin F. TITLE A history of TFIIH: two decades of molecular biology on a pivotal transcription/repair factor JOURNAL DNA Repair (Amst) 10 (7), 714-721 (2011) PUBMED 21592869 REMARK Review article REFERENCE 6 (bases 1 to 1314) AUTHORS Kershnar E, Wu SY and Chiang CM. TITLE Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes JOURNAL J Biol Chem 273 (51), 34444-34453 (1998) PUBMED 9852112 REFERENCE 7 (bases 1 to 1314) AUTHORS Reardon JT, Ge H, Gibbs E, Sancar A, Hurwitz J and Pan ZQ. TITLE Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH JOURNAL Proc Natl Acad Sci U S A 93 (13), 6482-6487 (1996) PUBMED 8692841 REMARK Erratum:[Proc Natl Acad Sci U S A 1996 Sep 17;93(19):10538] REFERENCE 8 (bases 1 to 1314) AUTHORS Weiler MC, Smith JL and Masters JN. TITLE CR16, a novel proline-rich protein expressed in rat brain neurons, binds to SH3 domains and is a MAP kinase substrate JOURNAL J Mol Neurosci 7 (3), 203-215 (1996) PUBMED 8906616 REFERENCE 9 (bases 1 to 1314) AUTHORS Ossipow V, Tassan JP, Nigg EA and Schibler U. TITLE A mammalian RNA polymerase II holoenzyme containing all components required for promoter-specific transcription initiation JOURNAL Cell 83 (1), 137-146 (1995) PUBMED 7553866 REFERENCE 10 (bases 1 to 1314) AUTHORS Serizawa H, Makela TP, Conaway JW, Conaway RC, Weinberg RA and Young RA. TITLE Association of Cdk-activating kinase subunits with transcription factor TFIIH JOURNAL Nature 374 (6519), 280-282 (1995) PUBMED 7885450 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000065.1. On Dec 21, 2021 this sequence version replaced XM_039103488.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR8487231.52780.1, SRR8487227.292185.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-172 JACYVU010000065.1 24370521-24370692 c 173-232 JACYVU010000065.1 24370200-24370259 c 233-266 JACYVU010000065.1 24364425-24364458 c 267-334 JACYVU010000065.1 24363058-24363125 c 335-403 JACYVU010000065.1 24361010-24361078 c 404-514 JACYVU010000065.1 24357799-24357909 c 515-633 JACYVU010000065.1 24356730-24356848 c 634-733 JACYVU010000065.1 24353969-24354068 c 734-820 JACYVU010000065.1 24352329-24352415 c 821-970 JACYVU010000065.1 24348683-24348832 c 971-1118 JACYVU010000065.1 24346920-24347067 c 1119-1314 JACYVU010000065.1 24345828-24346023 c FEATURES Location/Qualifiers source 1..1314 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="2" /map="2q12" gene 1..1314 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="cyclin-dependent kinase 7" /db_xref="GeneID:171150" /db_xref="RGD:621124" exon 1..172 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" misc_feature 23..25 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="upstream in-frame stop codon" CDS 107..1147 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /EC_number="2.7.11.23" /EC_number="2.7.11.22" /note="isoform 1 is encoded by transcript variant 1; cell division protein kinase 7; 39 protein kinase; CDK-activating kinase 1; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase)" /codon_start=1 /product="cyclin-dependent kinase 7 isoform 1" /protein_id="NP_001385585.1" /db_xref="GeneID:171150" /db_xref="RGD:621124" /translation="
MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLQHIFIAAGDDLLELIQGLFLFNPCTRITASQALRTKYFSNRPGPTPGCQLPRPNCPVEALKEQSNPAMATKRKRAEALEQGILPKKLIF"
misc_feature 137..1030 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7; Region: STKc_CDK7; cd07841" /db_xref="CDD:270833" misc_feature order(158..169,173..178,182..184,221..223,227..229, 287..289,329..331,377..388,395..397,401..406,515..517, 521..523,527..532,536..538,569..571,578..580,584..586, 614..616,620..631,635..637,749..754) /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="active site" /db_xref="CDD:270833" misc_feature order(158..160,164..178,182..184,221..223,227..229, 329..331,377..388,527..532,584..586) /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:270833" misc_feature order(263..271,275..277,284..289,293..298,305..310, 344..346,350..352,365..367,482..484,491..502,584..586, 590..601,611..616,947..949,959..967) /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="CDK/cyclin interface [polypeptide binding]; other site" /db_xref="CDD:270833" misc_feature order(287..289,401..403,515..517,521..523,578..580, 614..616,620..631,635..637,749..754) /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="polypeptide substrate binding site [polypeptide binding]; other site" /db_xref="CDD:270833" misc_feature order(566..601,605..637) /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /note="activation loop (A-loop); other site" /db_xref="CDD:270833" exon 173..232 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 233..266 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 267..334 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 335..403 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 404..514 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 515..633 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 634..733 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 734..820 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 821..970 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 971..1118 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" exon 1119..1314 /gene="Cdk7" /gene_synonym="CAK; P39 Mo15" /inference="alignment:Splign:2.1.0" ORIGIN
atgcgcgtccagtgaacggaagtagctgttggaaactttcagacgctttaaattcctgcggggtggagggcttagtttagctgctggacgctggcttctcactcgtatggctgtggacgtgaaatctcgagcgaagcgctatgagaaactggacttcctcggagagggacagtttgctactgtctataaggccagagataagaacaccaaccagatcgtcgccattaagaaaatcaaacttggacacaggtcagaagctaaagatggtataaatagaacagccttaagggagataaagctcttgcaggaactaagtcatccaaatataattggtctccttgatgcatttggacataaatcgaacattagccttgtctttgattttatggagactgacctagaggttatcataaaggataacagtctcgtgttgaccccatcccacattaaagcctacatgctgatgactcttcagggcttggaatatttacatcagcactggattctacacagggatctgaaaccaaacaacttgttgttagatgagaatggagttctgaaactggcagattttggcctggccaaatcatttgggagccccaatagggcttacacacatcaagttgtgaccaggtggtaccgggcccccgagttactgtttggagctaggatgtacggtgtgggagtggacatgtgggctgtcggttgtatcttagcagaattgcttctaagggttccttttttgcctggagattcagaccttgatcagctaacaagaatatttgaaactctgggtacaccaaccgaagaacagtggcctgacatgtgtagtcttccagattacgtgacgttcaagagtttccctggcatccccctgcagcacatcttcattgcagctggagacgacctgcttgagctcatacaaggcttgttcttattcaacccatgtactagaattacagcttcacaggcgttgaggaccaagtacttcagtaatcgtccagggccaacacctggatgccagcttccaagaccaaactgtccagtggaagcattaaaggaacagtcaaatccagccatggcgacaaaacggaaaagagcggaggccttagaacaaggaatattgcccaagaagctaattttttagttgcagcgaacaatggacagtttcactgctgaaagaaatgatccaaaggcaaataacggaaaaaaaatagggaatattaaatactatataagaacttgtaaatactctacagatgtaaaatatgtaaagctatgggttatttttattaaatgtattttaaaataaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]