2024-05-15 00:14:19, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001317181 7378 bp mRNA linear ROD 28-DEC-2023 DEFINITION Rattus norvegicus argonaute RISC component 1 (Ago1), transcript variant 1, mRNA. ACCESSION NM_001317181 VERSION NM_001317181.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 7378) AUTHORS Zhan J, Hu P and Wang Y. TITLE lncRNA PVT1 aggravates doxorubicin-induced cardiomyocyte apoptosis by targeting the miR-187-3p/AGO1 axis JOURNAL Mol Cell Probes 49, 101490 (2020) PUBMED 31786333 REMARK GeneRIF: lncRNA PVT1 aggravates doxorubicin-induced cardiomyocyte apoptosis by targeting the miR-187-3p/AGO1 axis. REFERENCE 2 (bases 1 to 7378) AUTHORS Ghosh U and Adhya S. TITLE Posttranscriptional regulation of cyclin D1 by ARE-binding proteins AUF1 and HuR in cycling myoblasts JOURNAL J Biosci 43 (4), 685-691 (2018) PUBMED 30207314 REMARK GeneRIF: Knockdown (KD) of AUF1 resulted in (1) transient upregulation of the mRNA level as well as an advancement of translation onset time (TOT) from 6 to 5 h post-serum addition, (2) loss of miRNA loading on AGO1 and AGO2 and (3) reduction in the level of AGO-1 and AGO-2 bound mRNA. REFERENCE 3 (bases 1 to 7378) AUTHORS Ghosh U and Adhya S. TITLE Non-equivalent Roles of AGO1 and AGO2 in mRNA Turnover and Translation of Cyclin D1 mRNA JOURNAL J Biol Chem 291 (13), 7119-7127 (2016) PUBMED 26846850 REMARK GeneRIF: AGO1 and AGO2 play non-equivalent roles of in mRNA turnover and translation of Ccnd1 mRNA. REFERENCE 4 (bases 1 to 7378) AUTHORS Sun S, Ma J, Zhang Q, Wang Q, Zhou L, Bai F, Hu H, Chang P, Yu J and Gao B. TITLE Argonaute proteins in cardiac tissue contribute to the heart injury during viral myocarditis JOURNAL Cardiovasc Pathol 25 (2), 120-126 (2016) PUBMED 26764146 REFERENCE 5 (bases 1 to 7378) AUTHORS Eswarappa SM, Potdar AA, Koch WJ, Fan Y, Vasu K, Lindner D, Willard B, Graham LM, DiCorleto PE and Fox PL. TITLE Programmed translational readthrough generates antiangiogenic VEGF-Ax JOURNAL Cell 157 (7), 1605-1618 (2014) PUBMED 24949972 REFERENCE 6 (bases 1 to 7378) AUTHORS Chi SW, Zang JB, Mele A and Darnell RB. TITLE Argonaute HITS-CLIP decodes microRNA-mRNA interaction maps JOURNAL Nature 460 (7254), 479-486 (2009) PUBMED 19536157 REFERENCE 7 (bases 1 to 7378) AUTHORS Wu L, Fan J and Belasco JG. TITLE Importance of translation and nonnucleolytic ago proteins for on-target RNA interference JOURNAL Curr Biol 18 (17), 1327-1332 (2008) PUBMED 18771919 REFERENCE 8 (bases 1 to 7378) AUTHORS Hock J, Weinmann L, Ender C, Rudel S, Kremmer E, Raabe M, Urlaub H and Meister G. TITLE Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells JOURNAL EMBO Rep 8 (11), 1052-1060 (2007) PUBMED 17932509 REFERENCE 9 (bases 1 to 7378) AUTHORS Meister G, Landthaler M, Patkaniowska A, Dorsett Y, Teng G and Tuschl T. TITLE Human Argonaute2 mediates RNA cleavage targeted by miRNAs and siRNAs JOURNAL Mol Cell 15 (2), 185-197 (2004) PUBMED 15260970 REFERENCE 10 (bases 1 to 7378) AUTHORS Beier H and Grimm M. TITLE Misreading of termination codons in eukaryotes by natural nonsense suppressor tRNAs JOURNAL Nucleic Acids Res 29 (23), 4767-4782 (2001) PUBMED 11726686 REMARK Review article COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from JACYVU010000162.1 and FM038730.1. Summary: This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to a C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015]. Transcript Variant: This variant (1) encodes two isoforms, which result from the use of alternative in-frame translation termination codons. The shorter isoform (1) results from translation termination at the upstream UGA stop codon, while the longer isoform (1x) results from UGA stop codon readthrough to the downstream UAG termination codon. This RefSeq represents the longer, C-terminally extended isoform (1x). As the UGA stop codon has been reported to specify several alternative amino acids (tryptophan, cysteine, arginine and serine), its location in the longer isoform is denoted by an 'X'. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## RNAseq introns :: mixed/partial sample support SAMD00132261, SAMD00132262 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## stop codon readthrough :: inferred from conservation ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-228 JACYVU010000162.1 53306190-53306417 c 229-412 JACYVU010000162.1 53301214-53301397 c 413-533 JACYVU010000162.1 53299669-53299789 c 534-715 JACYVU010000162.1 53299098-53299279 c 716-852 JACYVU010000162.1 53298570-53298706 c 853-987 JACYVU010000162.1 53298216-53298350 c 988-1075 JACYVU010000162.1 53297994-53298081 c 1076-1223 JACYVU010000162.1 53297229-53297376 c 1224-1343 JACYVU010000162.1 53292901-53293020 c 1344-1466 JACYVU010000162.1 53292404-53292526 c 1467-1600 JACYVU010000162.1 53292137-53292270 c 1601-1785 JACYVU010000162.1 53286609-53286793 c 1786-1945 JACYVU010000162.1 53280199-53280358 c 1946-2036 JACYVU010000162.1 53279963-53280053 c 2037-2700 FM038730.1 6-669 2701-7378 JACYVU010000162.1 53271410-53276087 c FEATURES Location/Qualifiers source 1..7378 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="5" /map="5q36" gene 1..7378 /gene="Ago1" /gene_synonym="Eif2c1" /note="argonaute RISC component 1" /db_xref="GeneID:313594" /db_xref="RGD:1304619" exon 1..228 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" CDS 204..2891 /gene="Ago1" /gene_synonym="Eif2c1" /note="isoform 1x is encoded by transcript variant 1; protein argonaute-1; eukaryotic translation initiation factor 2C, 1; argonaute 1, RISC catalytic component; argonaute RISC catalytic component 1" /codon_start=1 /transl_except=(pos:2775..2777,aa:OTHER) /product="protein argonaute-1 isoform 1x" /protein_id="NP_001304110.1" /db_xref="GeneID:313594" /db_xref="RGD:1304619" /translation="
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLERDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQALAKAVQVHQDTLRTMYFAXRQNAVTSLDRRKLSKPWELCHPNPEEARQRELGSDGT"
misc_feature 303..695 /gene="Ago1" /gene_synonym="Eif2c1" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:435368" misc_feature 723..875 /gene="Ago1" /gene_synonym="Eif2c1" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:430160" misc_feature 876..1238 /gene="Ago1" /gene_synonym="Eif2c1" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1032..1034,1077..1079,1119..1121,1131..1133, 1185..1187,1206..1208,1212..1214) /gene="Ago1" /gene_synonym="Eif2c1" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1371..2648 /gene="Ago1" /gene_synonym="Eif2c1" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the...; Region: Piwi_ago-like; cd04657" /db_xref="CDD:240015" misc_feature order(1782..1784,1794..1796,1830..1841,1848..1850, 1872..1874,1881..1883,1893..1895,1905..1907) /gene="Ago1" /gene_synonym="Eif2c1" /note="5' RNA guide strand anchoring site [active]" /db_xref="CDD:240015" misc_feature order(1986..1988,1992..1994,2202..2204,2616..2618) /gene="Ago1" /gene_synonym="Eif2c1" /note="active site" /db_xref="CDD:240015" exon 229..412 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 413..533 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 534..715 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 716..852 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 853..987 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 988..1075 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1076..1223 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1224..1343 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1344..1466 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1467..1600 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1601..1785 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1786..1945 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 1946..2036 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 2037..2231 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 2232..2366 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 2367..2468 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 2469..2668 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" exon 2669..7378 /gene="Ago1" /gene_synonym="Eif2c1" /inference="alignment:Splign:2.1.0" misc_feature 2775..2777 /gene="Ago1" /gene_synonym="Eif2c1" /note="upstream translation termination codon, use of which results in the shorter isoform 1" ORIGIN
actcgggcgctagcagggggagctgctgcaggctccgcggcggcggcaacggaggctgcgggggcgacagcgcgagcggccgggcttcgggggggagccgagcccggcccgggagcccgagcagtgcaagtgcgaggtacctaggcccctcacgctggactcctcagtctcccggccgcctgtcctccgcacgggtatatgggatggaagcgggaccctcgggagcagctgcaggtgcctacctgcctcccctgcagcaggtgttccaggcccctcgccggcctggcatcggcactgtgggcaaaccgatcaagcttctggccaattactttgaggtggacattcctaagattgacgtctaccattacgaggtggacatcaagccggataagtgtcctcgcagagtcaaccgggaggtggtggagtacatggtccagcatttcaaaccgcagatctttggggatcgcaagcctgtgtacgatggaaagaagaacatttacacagttacagcactgcctattggcaatgagagggttgactttgaggtgaccatccctggggaagggaaggatagaatttttaaggtctccatcaagtggctagccatcgtgagctggcgcatgctgcatgaagccttggtcagtggccagatccctgtgcccttggagtccgtgcaagccctggatgtggccatgaggcatctggcatctatgaggtacacccctgtgggccgctccttcttctcaccgcctgagggctactaccacccgctggggggtgggcgcgaggtctggttcggctttcaccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtctcagccactgccttctacaaagcacagccagtgattgagttcatgtgtgaggtcctggacatcaggaacatagatgaacagcccaagcccctcacggattcccagcgcgttcggtttaccaaggagataaagggcctgaaggtggaagtgacccactgtggacagatgaagaggaaataccgcgtgtgtaatgttacccgtcgccctgctagccatcagacgtttcccttgcagctggagagcggacagaccgtggagtgcaccgtggcacaatatttcaagcagaaatacaaccttcagctcaagtatcctcacctgccctgcctgcaagttgggcaagagcagaagcatacctatttgcccctcgaggtctgtaacattgtggctgggcagcggtgcattaagaagctgactgacaaccagacttcaaccatgataaaggctacagctaggtcggccccagacagacaggaggagatcagtcgcctgatgaagaacgccagctacaacttggatccctacatccaggaatttggaatcaaagtgaaggatgacatgacggaggtgacggggcgagtgctgccggcgcccatcttgcagtacggcggccggaaccgggccattgctacacccaaccaaggtgtctgggacatgcgtgggaaacagttctacaatgggattgagatcaaagtctgggccatcgcctgcttcgcaccccaaaaacaatgtcgagaagaggtgctcaagaacttcacggaccagcttcggaagatctccaaggatgcagggatgcccatccagggtcagccatgtttctgcaaatacgcacagggggcggacagcgtggagcccatgttccggcatctcaagaatacctactcaggactgcagctcattattgtcatcctgcccgggaagacgccggtgtatgctgaagtgaagcgtgttggagatacgctcttgggaatggcgacacagtgtgtgcaggtgaagaatgtggtcaagacctcacctcagactctgtccaacctctgcctcaagatcaatgtcaaactcggtggcatcaacaacatccttgtcccacaccagcgctctgctgttttccaacagccagtgatttttctgggagcagacgttacacaccccccggctggggacgggaagaaaccatctatcacagcagtggtaggcagtatggatgcacaccccagccgatactgtgccactgtgcgtgtacagcgtccacggcaggagatcattgaggacttgtcctatatggtgcgggagctgctcatccagttctacaagtccacccgattcaagcccacccgaatcatcttctaccgagatggggtccctgaaggccagctgcctcagatccttcactatgagctgcttgccattcgagatgcctgcatcaaactggaaagagactaccagcctgggatcacgtacatcgtggtacagaagcgacatcacacccgcctcttttgtgctgacaagaatgagcggattgggaagagtggtaacatcccagctgggaccactgtggacaccaacatcactcacccgtttgagtttgacttctacctgtgcagccatgcaggcatccagggcaccagccgaccatcccattattatgtcctttgggatgacaaccgtttcacagcagatgagctccagatcttgacataccagctgtgccacacttatgtacgatgcacacgttctgtctctatcccagcacctgcctactatgcccgcctggtggctttccgggcccgataccacctggtggacaaggagcatgacagtggagaggggagccacatatctgggcagagcaatgggcgagacccccaggccctggccaaagccgtgcaggttcaccaggatactctacgcaccatgtacttcgcttgaaggcagaacgctgttacctcactggacagaagaaagctttccaagccctgggagctgtgccacccaaatccagaggaagcaaggcagagggagctggggtcagatggaacataggaggccttgtttctatctacagagggggtatgagggtgggaagaggaccaccaagacagattaccagccagaaatctctgatagcaacctcatgtcctccacccctctccccatcttgtcacatccgacccccctggaccaaaaggggcattactagtgcccaccatacacacagttgtctcatgtgactcacagtgctaaagactcatgctcgacagcttgctagggtcaggtctgcagccctgtggtcaaatgctggtatgtttgggtttgatattctagatgagaaagtgggtgggaagagggaaggaatttttaggagccttaatcagaaaaggtctagatttgttgaagaaaaatgaaaacagactcagatcaatattttaggatactagatgttttcatgggttcagaatccagtttgtaggaagatttttaatgctaacggtttgggttgctccgccccagctgccacccctcccattattcctctccatgttctctacccccactcgcctctccctgacagacatccagccctagtaacacttaaggcactatggcacttagctctgaggtgacacgaccctgtcttccttccgcctgctggtgggtaaccagtgccttcccgtaagggtaatgctgcagaactgcaaccttttgtacctttctctgtgggatggggtgtgggtgggagaggaggtagggagggagggacgagctatcccaatgccagcaagcctacagccagaatgccaggtaattttcatttgaaggaatttgcttccataatcattgagcttcttaaaaaaaaaaaaaaaaaatcacaacctcagatggttaaaatccattgacatttgcactttcagacatgactagtctccgagctgctgagatgactggcccttggcctttcccctcttccctggccccacctccacccccaccccacccccaccatgccaggtctagagctactgtcctagtatttctcattcttggcttctttcccccctgatggtaaagactcttttgtttcaatatttcttaactggggtgtcttacaacagaagatcttaaggactaacataagaaaacagaaaactaaatgttatttttataccataacttgagtctattgccaaaatctgaaaatccctcccaaacctgatgactctgcatcccagaaacatggagccatcagaaggaactgtggacctgacttgtattctaacctggccaaggtggggggtggttgtctccccaaggtggggcttagcctctatcttccctctgtgcagataataccttgttgtcgagacggccttcctccacggcgctgtctgtcccgcactctgccttgtaagtgcatcttccctttttctggactggactgtcctttgactccttgactaaccgagactctagcatgtcctctggacaggctcgagaattttgctgctcccttttgcttctgtttacacaaatgaaattttcctgtttcccactagggcatgtgagtgggtagcatgggcttttctttttctacccctctcttgagatactggggttgagctgtcttgcaggactggaaaagaagtgggttctagctttgtccttgctgaccttgaagcgaggccccctctttcctcgactgttctttttttcttcctgcattattgcttgggatggggaatttgaacctctgtgtacaggttccccttctgaggagcctgagcttaggattgccctgctctggtgatgaagccatgatatttagatctagcccaggcatagaggccgctggagaaaggaaagtctgaaccctggcctatggagtcacaacctttccccaggagcccttgtacagacccaggtttgctatgcaaatagtccaggttcagttgtggctggctacattgttcagtaacttcccaacaggtagcacaaacattccttatgggaaaagcccagggctgttcagtagttcctcctgtacttcttttctgctggctacagtatggagtgccccgtgggcacaggcccagctgaagaacacaatggagggctctgggaagaggcagctcactggagagcctacattccttacacaagtgcctaaacagagtgatgccaacactccatctgccctgcccatcgccttcatagacagtctacttcctgttccgtcaccctttggggagggagctcttcgcagacagtgtgctgtcagcttgggtacatttgagggcttggattaagggcactactccagaagggtcccgtcattcaccagcatttgcagatgcccgtggggaacaggtggctgtcacaactcccagcaacaagtttttgttctttctttctttgcctcactctctccagttgggttttcagctagaatgaaaatgaagcttcagccctttggtatttatgtgccatccaagaaataaaagccagagagtgctgggcgtgatggccatgtctgtagttctgttatctcagcactaaggctgaagcaggagatttgcaagtttgggtccacctgggctgctgagtgtggccagtgtgcaccatgtagcaagaccatgtgtccatagaaaggaatgagaaaaatgacttggggaatacatcttgctgtgatgtttaaacaattctttgagatttaactactgaccctgtaggttcttctcatttaaggtggtatgaacacattaaaaacagtgtcgccaagcctcagcttgtttggatttggtttaagtggtgcattgtaccaagctctgggaggattccaacctcatcttagagctttctcctcacccccacccccactcccactgccccccatccccgtttggctttccctttcctcttttcgcctcccctggcttccttttccttctccctcttccctcagcttgcttgctggctggcctgcctgcctgtctgcctgtgtgataatgaattctctgcatggctgcaatgatcccgctgttctttggcaaggtcaggcttagctcattgactacagaagaccaaaaacctgttcctcatgcccagtggtgttagccctgggctgcactgtcctcaagcttacactaggtcggagcagcgggcctgcctaactgacaaaatcagggaggtttctggcagtcccagcacctctccattttgtggagagggtttggaaaagaggtggtgatggggagtgcagctctgagttcagcccagtgtgacccagtggttgaggtggtagtgccagcctgcagggccagcctggagctgctgttgctgggaacttatgcttggactctgactaaagtcgaacataagtaggaaactgctctaaaaatctagttctcagctgcagcatggctcctctgtggctgggcagcagtgtttttgaacagttttctttttaaccagaattctgtgaatgatgccagggacatagttttcttagctggcccatgggaagtctacaaggctgctcagacctggcatcgggcatcacaaaggaggatggaatttcttccctttcagggtggaagagtcacctctgacctagccaaaaggcagttttgggaactcatgttgggaggaaggatttcgttttatttgtttttttttttttttttttgttttttttttttgtttttttgttttgttttgttttactgggctttagataacccaggatggtagttaattatgccttccttgggcagggattatggcagggatatgcaaggcactctaatacttagccttctaagcagactgggaaagggggattctctggttttctctttctccccacttactaggacttgccttctccctgagccacgagagaggctgggttggtgctctccccttactctgctcctactgacttagaacctctggctgctgtacgatagcccaggaaagggaatggaaagaatgggctcaaaacagtaatgtgaggaaggtgattcccttccttaaaaagggaaatcagaaactctccaagaattctgtaagtaaagacaatgtgtctgaatgcactgagtcctctggtgtcatagcaataaggaaaaatgaattgacttcctgtgcacacagtccaacctgatgggtgtatgttgttgcacttagcagccatgtggtgggcacgtgtgacaactctgggtttcactttattttctaaacttcttattcctctcaagtccagcatggatggggaaatgtccctggagccccgcagctgtgtacttgtttgcatttgtttcccattgagacttgtgtttgtgtcctgctttgagctgtaccctgtcccgtccattgtgaaattatcccagcagctgtaatgtacagttcccttctcaagcaagcaacagcagcacaatcctgtgttttataaagacaacagtggcttttatttctaaagtgtggtctctggcttttttttttcctgtcacaaaataaacggtgtattaattaca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]