2024-05-05 01:50:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001159739 1478 bp mRNA linear ROD 16-DEC-2022 DEFINITION Rattus norvegicus glutathione S-transferase alpha 3 (Gsta3), transcript variant 2, mRNA. ACCESSION NM_001159739 VERSION NM_001159739.2 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1478) AUTHORS Xiao Y, Zhang Z, Fu Y, Shan H, Cui S and Wu J. TITLE GSTA3 regulates TGF-beta1-induced renal interstitial fibrosis in NRK-52E cells as a component of the PI3K-Keap1/Nrf2 pathway JOURNAL J Int Med Res 47 (11), 5787-5801 (2019) PUBMED 31617428 REMARK GeneRIF: The PI3K-KEAP1/Nrf2-GSTA3 signaling pathway is a possible mechanism of resisting external stimulation of renal fibrosis factors. REFERENCE 2 (bases 1 to 1478) AUTHORS Chen H, Gan Q, Yang C, Peng X, Qin J, Qiu S, Jiang Y, Tu S, He Y, Li S, Yang H, Tao L and Peng Y. TITLE A novel role of glutathione S-transferase A3 in inhibiting hepatic stellate cell activation and rat hepatic fibrosis JOURNAL J Transl Med 17 (1), 280 (2019) PUBMED 31443720 REMARK GeneRIF: GSTA3 inhibited hepatic stellate cell activation and liver fibrosis Erratum:[J Transl Med. 2020 Apr 30;18(1):182. PMID: 32354374] Publication Status: Online-Only REFERENCE 3 (bases 1 to 1478) AUTHORS Xiao Y, Liu J, Peng Y, Xiong X, Huang L, Yang H, Zhang J and Tao L. TITLE GSTA3 Attenuates Renal Interstitial Fibrosis by Inhibiting TGF-Beta-Induced Tubular Epithelial-Mesenchymal Transition and Fibronectin Expression JOURNAL PLoS One 11 (9), e0160855 (2016) PUBMED 27602565 REMARK GeneRIF: Protein and mRNA expression of GSTA3 in UUO rats and NRK-52E cells were determined by Western blot and RT-PCR. siRNA and overexpression plasmid were transfected specifically to assess the role of GSTA3 in renal interstitial fibrosis Publication Status: Online-Only REFERENCE 4 (bases 1 to 1478) AUTHORS Ilic Z, Crawford D, Vakharia D, Egner PA and Sell S. TITLE Glutathione-S-transferase A3 knockout mice are sensitive to acute cytotoxic and genotoxic effects of aflatoxin B1 JOURNAL Toxicol Appl Pharmacol 242 (3), 241-246 (2010) PUBMED 19850059 REMARK Erratum:[Toxicol Appl Pharmacol. 2010 Jun 1;245(2):280. PMID: 20852735] REFERENCE 5 (bases 1 to 1478) AUTHORS Caruana G, Cullen-McEwen L, Nelson AL, Kostoulias X, Woods K, Gardiner B, Davis MJ, Taylor DF, Teasdale RD, Grimmond SM, Little MH and Bertram JF. TITLE Spatial gene expression in the T-stage mouse metanephros JOURNAL Gene Expr Patterns 6 (8), 807-825 (2006) PUBMED 16545622 REFERENCE 6 (bases 1 to 1478) AUTHORS Pulford DJ and Hayes JD. TITLE Characterization of the rat glutathione S-transferase Yc2 subunit gene, GSTA5: identification of a putative antioxidant-responsive element in the 5'-flanking region of rat GSTA5 that may mediate chemoprotection against aflatoxin B1 JOURNAL Biochem J 318 (Pt 1) (Pt 1), 75-84 (1996) PUBMED 8761455 REFERENCE 7 (bases 1 to 1478) AUTHORS Hayes JD, Nguyen T, Judah DJ, Petersson DG and Neal GE. TITLE Cloning of cDNAs from fetal rat liver encoding glutathione S-transferase Yc polypeptides. The Yc2 subunit is expressed in adult rat liver resistant to the hepatocarcinogen aflatoxin B1 JOURNAL J Biol Chem 269 (32), 20707-20717 (1994) PUBMED 8051171 REFERENCE 8 (bases 1 to 1478) AUTHORS Klinga-Levan K, Andersson A, Hanson C, Ridderstrom M, Stenberg G, Mannervik B, Vajdy M, Szpirer J, Szpirer C and Levan G. TITLE Mapping of glutathione transferase (GST) genes in the rat JOURNAL Hereditas 119 (3), 285-296 (1993) PUBMED 8144363 REFERENCE 9 (bases 1 to 1478) AUTHORS Hayes JD, Judah DJ, McLellan LI, Kerr LA, Peacock SD and Neal GE. TITLE Ethoxyquin-induced resistance to aflatoxin B1 in the rat is associated with the expression of a novel alpha-class glutathione S-transferase subunit, Yc2, which possesses high catalytic activity for aflatoxin B1-8,9-epoxide JOURNAL Biochem J 279 (Pt 2) (Pt 2), 385-398 (1991) PUBMED 1953636 REFERENCE 10 (bases 1 to 1478) AUTHORS Pickett,C.B., Telakowski-Hopkins,C.A., Ding,G.J., Argenbright,L. and Lu,A.Y. TITLE Rat liver glutathione S-transferases. Complete nucleotide sequence of a glutathione S-transferase mRNA and the regulation of the Ya, Yb, and Yc mRNAs by 3-methylcholanthrene and phenobarbital JOURNAL J Biol Chem 259 (8), 5182-5188 (1984) PUBMED 6325423 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000213.1. On Nov 23, 2013 this sequence version replaced NM_001159739.1. Transcript Variant: This variant (2) differs in the 5' UTR compared to variant 1. Variants 1 and 2 encode the same protein (isoform 1). Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the Celera genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: FQ219557.1, FQ231428.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760400 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-177 JACYVU010000213.1 13009111-13009287 178-285 JACYVU010000213.1 13021375-13021482 286-337 JACYVU010000213.1 13025464-13025515 338-470 JACYVU010000213.1 13027684-13027816 471-612 JACYVU010000213.1 13028879-13029020 613-744 JACYVU010000213.1 13031500-13031631 745-1478 JACYVU010000213.1 13034044-13034777 FEATURES Location/Qualifiers source 1..1478 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="9" /map="9q13" gene 1..1478 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="glutathione S-transferase alpha 3" /db_xref="GeneID:494500" /db_xref="RGD:1591980" exon 1..177 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" misc_feature 106..108 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="upstream in-frame stop codon" exon 178..285 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" CDS 199..864 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /EC_number="2.5.1.18" /note="isoform 1 is encoded by transcript variant 2; glutathione S-transferase alpha-5; GST Yc2; GST A5-5; glutathione S-transferase Yc2 subunit; glutathione S-transferase A3" /codon_start=1 /product="glutathione S-transferase alpha-5 isoform 1" /protein_id="NP_001153211.1" /db_xref="GeneID:494500" /db_xref="RGD:1591980" /translation="
MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS"
misc_feature 208..444 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens; Region: GST_N_Alpha; cd03077" /db_xref="CDD:239375" misc_feature order(229..231,235..237,241..243,247..252,259..261, 268..273,292..294,304..306,403..405,412..417) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="C-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature order(331..333,358..363,397..402) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="GSH binding site (G-site) [chemical binding]; other site" /db_xref="CDD:239375" misc_feature order(352..357,379..381,394..399,403..408,415..420, 430..432) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:239375" misc_feature 454..858 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="C-terminal, alpha helical domain of Class Alpha Glutathione S-transferases; Region: GST_C_Alpha; cd03208" /db_xref="CDD:198317" misc_feature order(454..459,463..465,475..483,487..492,499..501, 589..591) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="dimer interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(487..489,508..510,517..519,526..531,589..594, 601..603,652..663,670..672,679..684,691..696,703..705, 775..780,784..801) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="N-terminal domain interface [polypeptide binding]; other site" /db_xref="CDD:198317" misc_feature order(499..501,517..519,529..531,589..591,820..822, 844..846,856..858) /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /note="substrate binding pocket (H-site) [chemical binding]; other site" /db_xref="CDD:198317" exon 286..337 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" exon 338..470 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" exon 471..612 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" exon 613..744 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" exon 745..1478 /gene="Gsta3" /gene_synonym="Gsta5; Yc2" /inference="alignment:Splign:2.1.0" ORIGIN
ctagtcccttatgtaaattcctggcctctggacactgtaggagctgctttccccttattggattgtctccccttaactgggaagggctcattcaaatttaataaatagcttatagaacagcagaaactctttcatacgctggagctagcttttcagagggaacaactgtttaacaagagaactcaagcaattgctgccatgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccggtggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgacctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagattgacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaacctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggccgatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagtcttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttgaagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctggttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctgctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcctggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttcagttaattcagtcagctatggatacactgtacccacaaagccagcctcagaaagctctgcaacaatgaagtattttgactaaatgttgaccgtacttattgggagggtaacatgttttctaaggcttctgtgttaattcatatagacatgactcatgaggaattgctgggatgccatctagttgagttaaaacctcaatctcgatcacttcctcggatattttcttaatgttcaataaaacaaaacaagcttcttagacgctggagtatccaaacattgtcatgaaatagctgtcatatccttgtcaaacagcgtcacgtagaaaccctcgtgtcaaactctcttacgcaaaagtaatctttccttatggagagtgtcctttctagtgaaatacacgcagacgtgtgtgcactcaaactgtgaagaactgttttccttcaacttctgaatggttttcttattcaattactccgtcagtacatttatgtccaatatagagcagtcattcttcctgggagctgcatgaatgatgaatgtggcagggataatcatttacccagccccagagtctgtggatttctgtaataaatgtaataataaaagcttaggtattcctaata
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]