GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-09 04:28:12, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001135010             843 bp    mRNA    linear   ROD 01-JUN-2018
DEFINITION  Rattus norvegicus mast cell protease 8-like 2 (Mcpt8l2), mRNA.
ACCESSION   NM_001135010 XM_573782
VERSION     NM_001135010.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 843)
  AUTHORS   Puente XS and Lopez-Otin C.
  TITLE     A genomic analysis of rat proteases and protease inhibitors
  JOURNAL   Genome Res. 14 (4), 609-622 (2004)
   PUBMED   15060002
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from
            AABR07017922.1.
            
            On Sep 16, 2008 this sequence version replaced XM_573782.2.
            
            Summary: member of the serine protease family [RGD, Feb 2006].
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ229939.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMEA2689594, SAMEA2689596
                                           [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-66                AABR07017922.1     5361-5426           c
            67-217              AABR07017922.1     4044-4194           c
            218-350             AABR07017922.1     3598-3730           c
            351-605             AABR07017922.1     3120-3374           c
            606-843             AABR07017922.1     2473-2710           c
FEATURES             Location/Qualifiers
     source          1..843
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="mixed"
                     /db_xref="taxon:10116"
                     /chromosome="15"
                     /map="15p13"
     gene            1..843
                     /gene="Mcpt8l2"
                     /note="mast cell protease 8-like 2"
                     /db_xref="GeneID:408240"
                     /db_xref="RGD:1302938"
     exon            1..66
                     /gene="Mcpt8l2"
                     /inference="alignment:Splign:2.0.8"
     CDS             12..758
                     /gene="Mcpt8l2"
                     /codon_start=1
                     /product="mast cell protease 8-like 2 precursor"
                     /protein_id="NP_001128482.1"
                     /db_xref="GeneID:408240"
                     /db_xref="RGD:1302938"
                     /translation="
MFLFLFFLVAVLPVNTEGGEIIWGTESKPHSRPYMAFIKFYDSNSEPQSCGGFLVAKDIVMTAAHCNGRNIKVTLGAHNIRKRENTQVISVVKAKPHENYDKHSRFNDIMLLKLERKAQLNGAVKTIALPRSQDWVKPGQVCTVAGWGHLANCTSSNTLQEVNLEVQKGQKCQDMSKDYNDSIQLCVGNPKEGKATSERDSGGPFVCDGVAQGIVSRCLCTGTLPRVFTRISSFIPWIQKTMKLLQQS"
     sig_peptide     12..65
                     /gene="Mcpt8l2"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    72..734
                     /gene="Mcpt8l2"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    72..74
                     /gene="Mcpt8l2"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(204..206,333..335,612..614)
                     /gene="Mcpt8l2"
                     /note="active site"
                     /db_xref="CDD:238113"
     exon            67..217
                     /gene="Mcpt8l2"
                     /inference="alignment:Splign:2.0.8"
     exon            218..350
                     /gene="Mcpt8l2"
                     /inference="alignment:Splign:2.0.8"
     exon            351..605
                     /gene="Mcpt8l2"
                     /inference="alignment:Splign:2.0.8"
     exon            606..843
                     /gene="Mcpt8l2"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
ccctgaagaggatgttcctgttcctgttcttcctggtggctgtcctaccagtcaacactgaaggaggagagatcatatggggtacagagtccaaaccccactcccggccctacatggcattcataaagttttatgatagtaattcagaaccccaaagttgtggcggttttctggtggcaaaagacatcgtaatgacagcagctcactgtaatggaagaaatataaaagtaaccttaggtgctcacaatatcagaaaacgagaaaacacccaggtcatctctgttgtaaaagccaaacctcacgagaactatgacaaacattcacggtttaatgacatcatgctcctgaagttggaacgcaaagctcaactcaatggtgctgtgaagacgattgcccttcctaggagccaggactgggtgaaacctgggcaggtgtgcacagtggcaggttggggacacttggccaattgtacttcatctaacacacttcaagaagtgaatctagaagttcagaaaggccagaagtgccaagacatgtccaaagactacaacgactccatccagctttgtgtgggaaaccccaaggaggggaaggctaccagtgagagagactcagggggtccctttgtgtgtgatggagtggcccagggcattgtcagtcgttgcttgtgtactgggacacttcctcgagtattcaccagaatctccagctttataccgtggattcagaaaacaatgaaactccttcaacaatcctagaacacaaaacctgtgtctgggccaatgtccagcatcctggggtatggctatctgagtcttaataaagaaatctgtctgcaggaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]