2024-04-28 04:16:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001135010 843 bp mRNA linear ROD 01-JUN-2018 DEFINITION Rattus norvegicus mast cell protease 8-like 2 (Mcpt8l2), mRNA. ACCESSION NM_001135010 XM_573782 VERSION NM_001135010.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 843) AUTHORS Puente XS and Lopez-Otin C. TITLE A genomic analysis of rat proteases and protease inhibitors JOURNAL Genome Res. 14 (4), 609-622 (2004) PUBMED 15060002 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AABR07017922.1. On Sep 16, 2008 this sequence version replaced XM_573782.2. Summary: member of the serine protease family [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: FQ229939.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMEA2689594, SAMEA2689596 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-66 AABR07017922.1 5361-5426 c 67-217 AABR07017922.1 4044-4194 c 218-350 AABR07017922.1 3598-3730 c 351-605 AABR07017922.1 3120-3374 c 606-843 AABR07017922.1 2473-2710 c FEATURES Location/Qualifiers source 1..843 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="mixed" /db_xref="taxon:10116" /chromosome="15" /map="15p13" gene 1..843 /gene="Mcpt8l2" /note="mast cell protease 8-like 2" /db_xref="GeneID:408240" /db_xref="RGD:1302938" exon 1..66 /gene="Mcpt8l2" /inference="alignment:Splign:2.0.8" CDS 12..758 /gene="Mcpt8l2" /codon_start=1 /product="mast cell protease 8-like 2 precursor" /protein_id="NP_001128482.1" /db_xref="GeneID:408240" /db_xref="RGD:1302938" /translation="
MFLFLFFLVAVLPVNTEGGEIIWGTESKPHSRPYMAFIKFYDSNSEPQSCGGFLVAKDIVMTAAHCNGRNIKVTLGAHNIRKRENTQVISVVKAKPHENYDKHSRFNDIMLLKLERKAQLNGAVKTIALPRSQDWVKPGQVCTVAGWGHLANCTSSNTLQEVNLEVQKGQKCQDMSKDYNDSIQLCVGNPKEGKATSERDSGGPFVCDGVAQGIVSRCLCTGTLPRVFTRISSFIPWIQKTMKLLQQS"
sig_peptide 12..65 /gene="Mcpt8l2" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 72..734 /gene="Mcpt8l2" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 72..74 /gene="Mcpt8l2" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(204..206,333..335,612..614) /gene="Mcpt8l2" /note="active site" /db_xref="CDD:238113" exon 67..217 /gene="Mcpt8l2" /inference="alignment:Splign:2.0.8" exon 218..350 /gene="Mcpt8l2" /inference="alignment:Splign:2.0.8" exon 351..605 /gene="Mcpt8l2" /inference="alignment:Splign:2.0.8" exon 606..843 /gene="Mcpt8l2" /inference="alignment:Splign:2.0.8" ORIGIN
ccctgaagaggatgttcctgttcctgttcttcctggtggctgtcctaccagtcaacactgaaggaggagagatcatatggggtacagagtccaaaccccactcccggccctacatggcattcataaagttttatgatagtaattcagaaccccaaagttgtggcggttttctggtggcaaaagacatcgtaatgacagcagctcactgtaatggaagaaatataaaagtaaccttaggtgctcacaatatcagaaaacgagaaaacacccaggtcatctctgttgtaaaagccaaacctcacgagaactatgacaaacattcacggtttaatgacatcatgctcctgaagttggaacgcaaagctcaactcaatggtgctgtgaagacgattgcccttcctaggagccaggactgggtgaaacctgggcaggtgtgcacagtggcaggttggggacacttggccaattgtacttcatctaacacacttcaagaagtgaatctagaagttcagaaaggccagaagtgccaagacatgtccaaagactacaacgactccatccagctttgtgtgggaaaccccaaggaggggaaggctaccagtgagagagactcagggggtccctttgtgtgtgatggagtggcccagggcattgtcagtcgttgcttgtgtactgggacacttcctcgagtattcaccagaatctccagctttataccgtggattcagaaaacaatgaaactccttcaacaatcctagaacacaaaacctgtgtctgggccaatgtccagcatcctggggtatggctatctgagtcttaataaagaaatctgtctgcaggaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]