2024-04-30 18:09:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001109875 626 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus crystallin, gamma B (Crygb), mRNA. ACCESSION NM_001109875 XM_001072315 XM_217421 VERSION NM_001109875.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 626) AUTHORS Li L, Chang B, Cheng C, Chang D, Hawes NL, Xia CH and Gong X. TITLE Dense nuclear cataract caused by the gammaB-crystallin S11R point mutation JOURNAL Invest Ophthalmol Vis Sci 49 (1), 304-309 (2008) PUBMED 18172107 REFERENCE 2 (bases 1 to 626) AUTHORS Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J. TITLE Genetic and allelic heterogeneity of Cryg mutations in eight distinct forms of dominant cataract in the mouse JOURNAL Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004) PUBMED 15037589 REFERENCE 3 (bases 1 to 626) AUTHORS Sandilands A, Hutcheson AM, Long HA, Prescott AR, Vrensen G, Loster J, Klopp N, Lutz RB, Graw J, Masaki S, Dobson CM, MacPhee CE and Quinlan RA. TITLE Altered aggregation properties of mutant gamma-crystallins cause inherited cataract JOURNAL EMBO J 21 (22), 6005-6014 (2002) PUBMED 12426373 REFERENCE 4 (bases 1 to 626) AUTHORS Szpirer C, Szpirer J, Van Vooren P, Tissir F, Simon JS, Koike G, Jacob HJ, Lander ES, Helou K, Klinga-Levan K and Levan G. TITLE Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution JOURNAL Mamm Genome 9 (9), 721-734 (1998) PUBMED 9716657 REFERENCE 5 (bases 1 to 626) AUTHORS Santhiya ST, Abd-alla SM, Loster J and Graw J. TITLE Reduced levels of gamma-crystallin transcripts during embryonic development of murine Cat2nop mutant lenses JOURNAL Graefes Arch Clin Exp Ophthalmol 233 (12), 795-800 (1995) PUBMED 8626090 REFERENCE 6 (bases 1 to 626) AUTHORS Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De Jong WW. TITLE Differential synthesis of crystallins in the developing rat eye lens JOURNAL Exp Eye Res 50 (4), 429-437 (1990) PUBMED 2338125 REFERENCE 7 (bases 1 to 626) AUTHORS den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers JG. TITLE Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region JOURNAL Gene 78 (2), 201-213 (1989) PUBMED 2777080 REFERENCE 8 (bases 1 to 626) AUTHORS den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G. TITLE Concerted and divergent evolution within the rat gamma-crystallin gene family JOURNAL J Mol Biol 189 (1), 37-46 (1986) PUBMED 3783678 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from M19359.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN06680452, SAMN13663604 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..626 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="9" /map="9q32" gene 1..626 /gene="Crygb" /gene_synonym="Cryg2; Len" /note="crystallin, gamma B" /db_xref="GeneID:301468" /db_xref="RGD:1584991" exon 1..42 /gene="Crygb" /gene_synonym="Cryg2; Len" /inference="alignment:Splign:2.1.0" CDS 34..561 /gene="Crygb" /gene_synonym="Cryg2; Len" /note="CRY-gamma-B; gamma-B-crystallin; gamma-crystallin 1-2; crystallin, gamma polypeptide 2" /codon_start=1 /product="gamma-crystallin B" /protein_id="NP_001103345.1" /db_xref="GeneID:301468" /db_xref="RGD:1584991" /translation="
MGKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY"
misc_feature 40..279 /gene="Crygb" /gene_synonym="Cryg2; Len" /note="Beta/gamma crystallins; Region: XTALbg; smart00247" /db_xref="CDD:214583" misc_feature 283..297 /gene="Crygb" /gene_synonym="Cryg2; Len" /note="propagated from UniProtKB/Swiss-Prot (P10066.3); Region: Connecting peptide" misc_feature 301..546 /gene="Crygb" /gene_synonym="Cryg2; Len" /note="Beta/Gamma crystallin; Region: Crystall; pfam00030" /db_xref="CDD:394987" exon 43..285 /gene="Crygb" /gene_synonym="Cryg2; Len" /inference="alignment:Splign:2.1.0" exon 286..626 /gene="Crygb" /gene_synonym="Cryg2; Len" /inference="alignment:Splign:2.1.0" ORIGIN
acagctcccagggcatctcttactatcagcgagatgggaaagatcaccttcttcgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccgtccgcgtggacagtggctgctggatgctctatgagcgacccaactaccagggccaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgcctcatcccccaacactcgggcacttacagaatgaggatctacgaaagagatgacttcagaggacaaatgtcagagatcacagacgactgtctctctcttcaggatcgcttccacctcagcgagattcactccctcaatgtaatggagggctgctgggtcctctatgagatgcctagctacagagggcgccagtacctgctgaggccgggagagtacaggagatatcttgactggggggctgcaaacgccaaagttggctcttttagaagagtcatggatttttactgaggcattttgagactctacttttctcctctagaaactaataaaatatgtagcttatgattctggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]