GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-30 09:40:09, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001109875             626 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus crystallin, gamma B (Crygb), mRNA.
ACCESSION   NM_001109875 XM_001072315 XM_217421
VERSION     NM_001109875.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 626)
  AUTHORS   Li L, Chang B, Cheng C, Chang D, Hawes NL, Xia CH and Gong X.
  TITLE     Dense nuclear cataract caused by the gammaB-crystallin S11R point
            mutation
  JOURNAL   Invest Ophthalmol Vis Sci 49 (1), 304-309 (2008)
   PUBMED   18172107
REFERENCE   2  (bases 1 to 626)
  AUTHORS   Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J.
  TITLE     Genetic and allelic heterogeneity of Cryg mutations in eight
            distinct forms of dominant cataract in the mouse
  JOURNAL   Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004)
   PUBMED   15037589
REFERENCE   3  (bases 1 to 626)
  AUTHORS   Sandilands A, Hutcheson AM, Long HA, Prescott AR, Vrensen G, Loster
            J, Klopp N, Lutz RB, Graw J, Masaki S, Dobson CM, MacPhee CE and
            Quinlan RA.
  TITLE     Altered aggregation properties of mutant gamma-crystallins cause
            inherited cataract
  JOURNAL   EMBO J 21 (22), 6005-6014 (2002)
   PUBMED   12426373
REFERENCE   4  (bases 1 to 626)
  AUTHORS   Szpirer C, Szpirer J, Van Vooren P, Tissir F, Simon JS, Koike G,
            Jacob HJ, Lander ES, Helou K, Klinga-Levan K and Levan G.
  TITLE     Gene-based anchoring of the rat genetic linkage and cytogenetic
            maps: new regional localizations, orientation of the linkage
            groups, and insights into mammalian chromosome evolution
  JOURNAL   Mamm Genome 9 (9), 721-734 (1998)
   PUBMED   9716657
REFERENCE   5  (bases 1 to 626)
  AUTHORS   Santhiya ST, Abd-alla SM, Loster J and Graw J.
  TITLE     Reduced levels of gamma-crystallin transcripts during embryonic
            development of murine Cat2nop mutant lenses
  JOURNAL   Graefes Arch Clin Exp Ophthalmol 233 (12), 795-800 (1995)
   PUBMED   8626090
REFERENCE   6  (bases 1 to 626)
  AUTHORS   Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De
            Jong WW.
  TITLE     Differential synthesis of crystallins in the developing rat eye
            lens
  JOURNAL   Exp Eye Res 50 (4), 429-437 (1990)
   PUBMED   2338125
REFERENCE   7  (bases 1 to 626)
  AUTHORS   den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers
            JG.
  TITLE     Nucleotide sequence of the rat gamma-crystallin gene region and
            comparison with an orthologous human region
  JOURNAL   Gene 78 (2), 201-213 (1989)
   PUBMED   2777080
REFERENCE   8  (bases 1 to 626)
  AUTHORS   den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G.
  TITLE     Concerted and divergent evolution within the rat gamma-crystallin
            gene family
  JOURNAL   J Mol Biol 189 (1), 37-46 (1986)
   PUBMED   3783678
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from M19359.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN06680452,
                              SAMN13663604 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..626
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q32"
     gene            1..626
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /note="crystallin, gamma B"
                     /db_xref="GeneID:301468"
                     /db_xref="RGD:1584991"
     exon            1..42
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /inference="alignment:Splign:2.1.0"
     CDS             34..561
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /note="CRY-gamma-B; gamma-B-crystallin; gamma-crystallin
                     1-2; crystallin, gamma polypeptide 2"
                     /codon_start=1
                     /product="gamma-crystallin B"
                     /protein_id="NP_001103345.1"
                     /db_xref="GeneID:301468"
                     /db_xref="RGD:1584991"
                     /translation="
MGKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY"
     misc_feature    40..279
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /note="Beta/gamma crystallins; Region: XTALbg; smart00247"
                     /db_xref="CDD:214583"
     misc_feature    283..297
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /note="propagated from UniProtKB/Swiss-Prot (P10066.3);
                     Region: Connecting peptide"
     misc_feature    301..546
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /note="Beta/Gamma crystallin; Region: Crystall; pfam00030"
                     /db_xref="CDD:394987"
     exon            43..285
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /inference="alignment:Splign:2.1.0"
     exon            286..626
                     /gene="Crygb"
                     /gene_synonym="Cryg2; Len"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
acagctcccagggcatctcttactatcagcgagatgggaaagatcaccttcttcgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccgtccgcgtggacagtggctgctggatgctctatgagcgacccaactaccagggccaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgcctcatcccccaacactcgggcacttacagaatgaggatctacgaaagagatgacttcagaggacaaatgtcagagatcacagacgactgtctctctcttcaggatcgcttccacctcagcgagattcactccctcaatgtaatggagggctgctgggtcctctatgagatgcctagctacagagggcgccagtacctgctgaggccgggagagtacaggagatatcttgactggggggctgcaaacgccaaagttggctcttttagaagagtcatggatttttactgaggcattttgagactctacttttctcctctagaaactaataaaatatgtagcttatgattctggca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]