2024-05-03 23:09:58, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001106584 617 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus replication protein A3 (Rpa3), mRNA. ACCESSION NM_001106584 XM_001054662 XM_216097 VERSION NM_001106584.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 617) AUTHORS McJunkin K, Mazurek A, Premsrirut PK, Zuber J, Dow LE, Simon J, Stillman B and Lowe SW. TITLE Reversible suppression of an essential gene in adult mice using transgenic RNA interference JOURNAL Proc Natl Acad Sci U S A 108 (17), 7113-7118 (2011) PUBMED 21482754 REFERENCE 2 (bases 1 to 617) AUTHORS Sakaguchi K, Ishibashi T, Uchiyama Y and Iwabata K. TITLE The multi-replication protein A (RPA) system--a new perspective JOURNAL FEBS J 276 (4), 943-963 (2009) PUBMED 19154342 REMARK Review article REFERENCE 3 (bases 1 to 617) AUTHORS Salas TR, Petruseva I, Lavrik O and Saintome C. TITLE Evidence for direct contact between the RPA3 subunit of the human replication protein A and single-stranded DNA JOURNAL Nucleic Acids Res 37 (1), 38-46 (2009) PUBMED 19010961 REFERENCE 4 (bases 1 to 617) AUTHORS Li GM. TITLE Mechanisms and functions of DNA mismatch repair JOURNAL Cell Res 18 (1), 85-98 (2008) PUBMED 18157157 REMARK Review article REFERENCE 5 (bases 1 to 617) AUTHORS Sleeth KM, Sorensen CS, Issaeva N, Dziegielewski J, Bartek J and Helleday T. TITLE RPA mediates recombination repair during replication stress and is displaced from DNA by checkpoint signalling in human cells JOURNAL J Mol Biol 373 (1), 38-47 (2007) PUBMED 17765923 REFERENCE 6 (bases 1 to 617) AUTHORS Bochkareva E, Korolev S, Lees-Miller SP and Bochkarev A. TITLE Structure of the RPA trimerization core and its role in the multistep DNA-binding mechanism of RPA JOURNAL EMBO J 21 (7), 1855-1863 (2002) PUBMED 11927569 REFERENCE 7 (bases 1 to 617) AUTHORS DeMott MS, Zigman S and Bambara RA. TITLE Replication protein A stimulates long patch DNA base excision repair JOURNAL J Biol Chem 273 (42), 27492-27498 (1998) PUBMED 9765279 REFERENCE 8 (bases 1 to 617) AUTHORS Lin YL, Shivji MK, Chen C, Kolodner R, Wood RD and Dutta A. TITLE The evolutionarily conserved zinc finger motif in the largest subunit of human replication protein A is required for DNA replication and mismatch repair but not for nucleotide excision repair JOURNAL J Biol Chem 273 (3), 1453-1461 (1998) PUBMED 9430682 REFERENCE 9 (bases 1 to 617) AUTHORS Lopez-Girona A, Bachs O and Agell N. TITLE Calmodulin is involved in the induction of DNA polymerases alpha and delta activities in normal rat kidney cells activated to proliferate JOURNAL Biochem Biophys Res Commun 217 (2), 566-574 (1995) PUBMED 7503737 REFERENCE 10 (bases 1 to 617) AUTHORS He Z, Henricksen LA, Wold MS and Ingles CJ. TITLE RPA involvement in the damage-recognition and incision steps of nucleotide excision repair JOURNAL Nature 374 (6522), 566-569 (1995) PUBMED 7700386 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473959.1. On or before Oct 4, 2007 this sequence version replaced XM_216097.4, XM_001054662.1. ##Evidence-Data-START## Transcript exon combination :: FQ228706.1, BG661076.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support SAMD00132293, SAMD00132303 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..617 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="4" /map="4q21" gene 1..617 /gene="Rpa3" /note="replication protein A3" /db_xref="GeneID:296883" /db_xref="RGD:1306810" exon 1..130 /gene="Rpa3" /inference="alignment:Splign:2.1.0" CDS 32..397 /gene="Rpa3" /codon_start=1 /product="replication protein A 14 kDa subunit" /protein_id="NP_001100054.1" /db_xref="GeneID:296883" /db_xref="RGD:1306810" /translation="
MVDIMELPKARVNASMLSQYIERPVCFVGKLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGKVTAKATILCASYILFKEDCNRFDLELYNEAVKIINEFPQFFPLGLTQHE"
misc_feature 44..370 /gene="Rpa3" /note="Replication factor A protein 3; Region: Rep_fac-A_3; pfam08661" /db_xref="CDD:400821" misc_feature order(53..58,62..64,233..235,293..295,311..316,332..334, 341..343,347..349,353..358,365..370) /gene="Rpa3" /note="trimerization core interface [active]" /db_xref="CDD:239925" misc_feature order(53..58,62..64,233..235,293..295,311..316,347..349, 356..358,365..370) /gene="Rpa3" /note="RPA3/RPA2 DBD-D interface [polypeptide binding]; other site" /db_xref="CDD:239925" misc_feature order(122..130,149..160,164..166,185..193,197..199, 224..226,245..253,263..271) /gene="Rpa3" /note="generic binding surface I [active]" /db_xref="CDD:239925" misc_feature order(314..316,332..334,353..355) /gene="Rpa3" /note="RPA3/RPA1 DBD-C interface [polypeptide binding]; other site" /db_xref="CDD:239925" exon 131..205 /gene="Rpa3" /inference="alignment:Splign:2.1.0" exon 206..314 /gene="Rpa3" /inference="alignment:Splign:2.1.0" exon 315..617 /gene="Rpa3" /inference="alignment:Splign:2.1.0" ORIGIN
cctgcgggttgtgagttttggcggcagaatcatggtggacataatggaactccccaaagcgcgcgtcaacgccagcatgttatcacagtatatcgaacgacccgtgtgcttcgtggggaagctggaaaagattcatcccactggaaaaatgtttattctttcagatggagaaggaaagaatggaaccattgaattgatggagccactggatgaagaaatctctggaatcgtagaagtagtcgggaaggtgacagccaaggcaaccatactatgtgcatcttatatcctgtttaaggaagattgtaatcgctttgatcttgaactttacaatgaagctgtgaaaattatcaatgagtttcctcagttttttcctttagggcttacacaacatgaatgagcttcttgaatttcttaagattgccagtaagctacattgaaagttattaaagaagactccttcagtttaagggagagactcctataatttctaatatttaatttgcttttttatatatattttttgtaaatctactatgacagtttacatctaagtctttttataaattttttaaaatcgatacttcaatatatggtctgaataaaaagaaaattaaaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]