2024-05-09 06:38:24, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001106563 5164 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus vav guanine nucleotide exchange factor 2 (Vav2), mRNA. ACCESSION NM_001106563 XM_001075315 XM_001075347 XM_001075369 XM_001075402 XM_216030 VERSION NM_001106563.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 5164) AUTHORS Veluthakal R, Tunduguru R, Arora DK, Sidarala V, Syeda K, Vlaar CP, Thurmond DC and Kowluru A. TITLE VAV2, a guanine nucleotide exchange factor for Rac1, regulates glucose-stimulated insulin secretion in pancreatic beta cells JOURNAL Diabetologia 58 (11), 2573-2581 (2015) PUBMED 26224100 REMARK GeneRIF: Our data provide the first evidence to implicate VAV2 in glucose-induced Rac1 activation, actin remodelling and glucose-stimulated insulin secretion in pancreatic beta cells. REFERENCE 2 (bases 1 to 5164) AUTHORS Valderrama F, Thevapala S and Ridley AJ. TITLE Radixin regulates cell migration and cell-cell adhesion through Rac1 JOURNAL J Cell Sci 125 (Pt 14), 3310-3319 (2012) PUBMED 22467863 REFERENCE 3 (bases 1 to 5164) AUTHORS Antoni G, Oudot-Mellakh T, Dimitromanolakis A, Germain M, Cohen W, Wells P, Lathrop M, Gagnon F, Morange PE and Tregouet DA. TITLE Combined analysis of three genome-wide association studies on vWF and FVIII plasma levels JOURNAL BMC Med Genet 12, 102 (2011) PUBMED 21810271 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 5164) AUTHORS Mehlitz A, Banhart S, Maurer AP, Kaushansky A, Gordus AG, Zielecki J, Macbeath G and Meyer TF. TITLE Tarp regulates early Chlamydia-induced host cell survival through interactions with the human adaptor protein SHC1 JOURNAL J Cell Biol 190 (1), 143-157 (2010) PUBMED 20624904 REFERENCE 5 (bases 1 to 5164) AUTHORS Afshari FT, Kwok JC and Fawcett JW. TITLE Astrocyte-produced ephrins inhibit schwann cell migration via VAV2 signaling JOURNAL J Neurosci 30 (12), 4246-4255 (2010) PUBMED 20335460 REMARK GeneRIF: This study suggested that ephrinAs produced by astrocytes are involved in inhibition of Schwann cell migration and that this effect is mediated through EphA receptors on Schwann cells, leading to VAV2 signaling and interception of integrin function. REFERENCE 6 (bases 1 to 5164) AUTHORS Peng F, Zhang B, Ingram AJ, Gao B, Zhang Y and Krepinsky JC. TITLE Mechanical stretch-induced RhoA activation is mediated by the RhoGEF Vav2 in mesangial cells JOURNAL Cell Signal 22 (1), 34-40 (2010) PUBMED 19755152 REMARK GeneRIF: stretch-induced RhoA activation is dependent on transactivation of the EGFR and activation of the RhoGEF Vav2. REFERENCE 7 (bases 1 to 5164) AUTHORS Yi F, Xia M, Li N, Zhang C, Tang L and Li PL. TITLE Contribution of guanine nucleotide exchange factor Vav2 to hyperhomocysteinemic glomerulosclerosis in rats JOURNAL Hypertension 53 (1), 90-96 (2009) PUBMED 19029489 REMARK GeneRIF: Vav2-mediated activation of NADPH oxidase is an important initiating mechanism resulting in hyperhomocysteinemic glomerular injury through enhanced local oxidative stress. REFERENCE 8 (bases 1 to 5164) AUTHORS Aoki K, Nakamura T, Fujikawa K and Matsuda M. TITLE Local phosphatidylinositol 3,4,5-trisphosphate accumulation recruits Vav2 and Vav3 to activate Rac1/Cdc42 and initiate neurite outgrowth in nerve growth factor-stimulated PC12 cells JOURNAL Mol Biol Cell 16 (5), 2207-2217 (2005) PUBMED 15728722 REFERENCE 9 (bases 1 to 5164) AUTHORS Crespo P, Schuebel KE, Ostrom AA, Gutkind JS and Bustelo XR. TITLE Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product JOURNAL Nature 385 (6612), 169-172 (1997) PUBMED 8990121 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000115.1. On Jan 12, 2008 this sequence version replaced NM_001106563.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: mixed/partial sample support SAMD00132261, SAMD00132262 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-679 JACYVU010000115.1 4210195-4210873 c 680-796 JACYVU010000115.1 4169489-4169605 c 797-855 JACYVU010000115.1 4115678-4115736 c 856-924 JACYVU010000115.1 4095673-4095741 c 925-1027 JACYVU010000115.1 4079293-4079395 c 1028-1126 JACYVU010000115.1 4076602-4076700 c 1127-1195 JACYVU010000115.1 4074929-4074997 c 1196-1296 JACYVU010000115.1 4073490-4073590 c 1297-1396 JACYVU010000115.1 4070311-4070410 c 1397-1492 JACYVU010000115.1 4069495-4069590 c 1493-1561 JACYVU010000115.1 4069021-4069089 c 1562-1648 JACYVU010000115.1 4066302-4066388 c 1649-1734 JACYVU010000115.1 4064146-4064231 c 1735-1867 JACYVU010000115.1 4063353-4063485 c 1868-1977 JACYVU010000115.1 4060825-4060934 c 1978-2079 JACYVU010000115.1 4059321-4059422 c 2080-2168 JACYVU010000115.1 4059009-4059097 c 2169-2185 JACYVU010000115.1 4056974-4056990 c 2186-2207 JACYVU010000115.1 4056410-4056431 c 2208-2335 JACYVU010000115.1 4055498-4055625 c 2336-2410 JACYVU010000115.1 4054183-4054257 c 2411-2463 JACYVU010000115.1 4052868-4052920 c 2464-2580 JACYVU010000115.1 4050476-4050592 c 2581-2668 JACYVU010000115.1 4048581-4048668 c 2669-2792 JACYVU010000115.1 4047463-4047586 c 2793-2879 JACYVU010000115.1 4046764-4046850 c 2880-3034 JACYVU010000115.1 4045893-4046047 c 3035-5164 JACYVU010000115.1 4041509-4043638 c FEATURES Location/Qualifiers source 1..5164 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="3" /map="3p12" gene 1..5164 /gene="Vav2" /note="vav guanine nucleotide exchange factor 2" /db_xref="GeneID:296603" /db_xref="RGD:1306285" exon 1..679 /gene="Vav2" /inference="alignment:Splign:2.1.0" misc_feature 422..424 /gene="Vav2" /note="upstream in-frame stop codon" CDS 476..3082 /gene="Vav2" /note="Vav2 oncogene; vav 2 guanine nucleotide exchange factor" /codon_start=1 /product="guanine nucleotide exchange factor VAV2" /protein_id="NP_001100033.2" /db_xref="GeneID:296603" /db_xref="RGD:1306285" /translation="
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDINFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSIAQSKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMKMGLTEDDKRSCCLLEIQETEAKYYRTLEDIEKNYMGPLRQVLSPVDMATIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLEFKERLLIYGEYCSHMEHAQSALNQLLASRDDFRQKVEECTLKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSADRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQCSIENLQVKLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVIVCKRKGYSYELKEVIELLFHKMTDDPMHNKDIKKWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKACKMFLRGTFYQGYLCTRCGVGAHKECLEVIPPCKMSSPADADAPGAGLGPKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPDSPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPVGRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKFPYKSRERAATRASSRSPASCASYSFSFLSPQGLSFAPQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ"
misc_feature 479..835 /gene="Vav2" /note="calponin homology (CH) domain found in VAV2 protein and similar proteins; Region: CH_VAV2; cd21263" /db_xref="CDD:409112" misc_feature order(482..484,494..496,683..685,689..694,701..706, 710..712,743..769,785..787,791..796,800..805,812..817, 824..826) /gene="Vav2" /note="putative actin binding site [polypeptide binding]; other site" /db_xref="CDD:409112" misc_feature 1055..1582 /gene="Vav2" /note="Guanine nucleotide exchange factor for Rho/Rac/Cdc42-like GTPases; Also called Dbl-homologous (DH) domain. It appears that PH domains invariably occur C-terminal to RhoGEF/DH domains; Region: RhoGEF; cd00160" /db_xref="CDD:238091" misc_feature order(1073..1075,1085..1087,1352..1354,1436..1441, 1448..1453,1457..1462,1469..1474,1481..1486,1493..1495, 1568..1570,1580..1582) /gene="Vav2" /note="GTPase interaction site [polypeptide binding]; other site" /db_xref="CDD:238091" misc_feature 1625..1993 /gene="Vav2" /note="Vav pleckstrin homology (PH) domain; Region: PH_Vav; cd01223" /db_xref="CDD:269930" misc_feature 2000..2173 /gene="Vav2" /note="protein kinase C conserved region 1 (C1 domain) found in VAV2 protein; Region: C1_VAV2; cd20868" /db_xref="CDD:410418" misc_feature 2213..2392 /gene="Vav2" /note="First Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_1; cd11980" /db_xref="CDD:212913" misc_feature order(2228..2230,2234..2236,2243..2245,2267..2269, 2324..2329,2372..2374,2378..2383) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212913" misc_feature 2444..2752 /gene="Vav2" /note="Src homology 2 (SH2) domain found in the Vav2 proteins; Region: SH2_Vav2; cd10406" /db_xref="CDD:198269" misc_feature order(2483..2485,2537..2539,2600..2602,2606..2608) /gene="Vav2" /note="phosphotyrosine binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature order(2603..2605,2684..2686) /gene="Vav2" /note="hydrophobic binding pocket [polypeptide binding]; other site" /db_xref="CDD:198269" misc_feature 2900..3073 /gene="Vav2" /note="C-terminal (or second) Src homology 3 domain of VAV2 protein; Region: SH3_VAV2_2; cd11977" /db_xref="CDD:212910" misc_feature order(2918..2920,2924..2926,2933..2935,2945..2947, 3005..3010,3047..3049,3053..3058) /gene="Vav2" /note="peptide ligand binding site [polypeptide binding]; other site" /db_xref="CDD:212910" exon 680..796 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 797..855 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 856..924 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 925..1027 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1028..1126 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1127..1195 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1196..1296 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1297..1396 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1397..1492 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1493..1561 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1562..1648 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1649..1734 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1735..1867 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1868..1977 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 1978..2079 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2080..2168 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2169..2185 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2186..2207 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2208..2335 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2336..2410 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2411..2463 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2464..2580 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2581..2668 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2669..2792 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2793..2879 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 2880..3034 /gene="Vav2" /inference="alignment:Splign:2.1.0" exon 3035..5164 /gene="Vav2" /inference="alignment:Splign:2.1.0" ORIGIN
cggtggggcgagtagctcaggcgccggacgcagggaccgagcgacccgctgcgcctttgtctcgggtggggcaggagcggcggccggagcggggcgccccgaacgcagaatgcggcgcccagaggggcggatcgaagagcgctgcggcggcaggaggtgtggagcccgggccggagcccgagcgcacttgtgtgtgtgaaggggggacccggcacactgccccgagagcgcctagtggccgcacgtgggcgggagccgcggcccgctagtagcccgaggaggaggaggaggaagaggagggccgtgtggccgcgcagcggggacccggggccgcctgcgcgaagccccgccccggcggccgagccccgcgcgggcggtcgggatgctccgcggtcaccgcactttggccggagcgctgccctgagccagctggcccagcggccgcggcggcgagcgcacgggcgccgcgggcgccatggagcagtggcggcaatgcggccgctggctcattgactgcaaggtcctgccgcccaaccaccgcgtcgtgtggccctcggcggtggtcttcgacctggcgcaggcgctgcgcgacggcgtccttctgtgccagctgctgcacaacctctcccccggctccatcgaccttaaggacatcaacttccggccgcagatgtcccagttcctgtgtctgaagaatattcgcaccttcctcaaagtctgccacgacaaatttggactaaggaacagtgagctgtttgaccctttcgacctctttgatgtccgagacttcgggaaggtcatctctgccgtgtcccgtctgtccctgcacagcatcgcgcagagcaaagggatcaggccttttccatcagaggagacggctgaaaacgatgacgatgtctaccggagtctggaagagctggctgacgagcatgacctgggtgaggacatctacgactgtgtcccgtgtgaagatgaaggagatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgaaaatgggactaaccgaggacgacaagaggagctgctgcttgttagagattcaggagaccgaggccaagtactaccgcaccctggaggacattgagaagaactacatgggtcccttgcggcaggtgctgagccccgtggacatggccaccatcttcatcaacctggaggacctcatcaaggtgcaccacagctttctgcgagccatcgatgtgtccatgatggctggtggcagtaccctggctaaggtcttcctggagtttaaggaacggctcctgatctacggagagtactgtagccacatggagcatgcgcagagcgcactgaaccagctcctcgccagccgagacgacttcaggcagaaagtggaggagtgcacactcaaggtccaggagggcaagttcaagctgcaggatctgctggtggtgcccatgcagcgggtgctcaagtaccacctgttgctcaaggagctcctgagccattccgcagaccggcctgaaagacaacagctcaaagaagcactggaagccatgcaggacttggccatgtatattaatgaagtgaaacgggacaaggagaccttgaagaagattagtgagttccagtgctccatagaaaacctgcaagtgaagctggaggaatttgggaggccgaagattgacggggagctgaaagttcggtccatagtcaaccacaccaagcaagacaggtacctgttcctgtttgacaaggtggtcatcgtgtgtaagaggaagggctacagctatgagctgaaggaggttattgaactgctcttccacaagatgactgatgaccccatgcacaacaaagacatcaagaagtggtcctatggcttctacctgattcacctccaagggaagcaaggctttcagttcttctgcaagacggaagacatgaaacggaagtggatggagcagttcgagatggccatgtcaaacatcaagccagacaaggccaatgccaaccatcatagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgcaagatgttcctcaggggtaccttctaccagggatacctgtgtaccagatgtggtgtcggggcacacaaggagtgcctggaggtgatacccccctgcaagatgagttcgcctgcagatgcggacgctcccggagcaggactaggtcccaagatggttgccgtgcagaattaccatggtaacccagcccctcccgggaagcccgtgttgaccttccagacaggggatgtgatagagctgctccggggtgaccccgattctccttggtgggaggggaggctggttcaaactcggaagtcagggtatttccccagctcatctgtgaagccctgcccggtggacggaaggccgcctgttggccgcccgccatcccgggagatcgattacactgcatacccgtggttcgctggcaacatggaacggcagcagacggacaatctactcaagtctcatgccagcgggacctacctcatcagagagcgcccagcagaggcagagcgtttcgccatcagcatcaagttcaatgatgaagtgaaacacatcaaggtggtggaaaaagacagctggatccacatcacggaagctaagaagtttgagagcctcctggagctggtggagtactaccagtgccactcacttaaggagagcttcaagcagttagacactacactcaagttcccctacaagtctcgggagcgcgccgccaccagggcctcaagccgatctccagcttcgtgtgcttcctacagcttttcttttctcagtcctcagggcctcagctttgccccccagggcccctctgctcccttctggtcagtgttcacaccgcgggtcatcggcacagccgtggccaggtacaactttgctgcacgagacatgcgggagctgtcgctgcgggaaggtgatgtggtgaagatctacagccggatcggtggggaccagggctggtggaagggcgagacgaacgggcggatcggttggtttccttcgacgtacgtggaagaggaaggcatccagtgagggcgagacctggacagaacccacagatgctcttgggagtctccccagctctgaagtccgcctctggcttctccgtagctctgggaactgcctgctaagcctgcagctgttatggcccctagggatggggagggtgtcccaccatcacctgccctaggtggcctgtgcctgggtacattccttgtacatagaggagatccgtgctggccacacccagagcaccaaggatggggagctcaggccatatggccaagcatgtgtggatgacagcaaaggtcagaagctactgcctgcccctctggtttagatggttgctcaggagcccagacttcgactcatggtgtgccagggagggctggggacaacagggggtcccttcccaggcccatctgctgccccacactgatctgcctgtcttttctgctgctctctagagtgtgtgtcaggttttgggaggcaggcaggaccagagccaagctgtgctgtagcacactccaggcccagctgggagagagcttgcacaggggccgctggatcacgctagctctggagatttccctggctgcctcccttcctgacacagcagggtcctgctgcgtgctaactgggcaggcccctccctcatgagggaccttcggaccgatgacattgctgacccatccccagcccacccagtcagtggtactgctctttgcttgttgaagcccctttcctgagccaggaaacaggtcttttctgccctgctgccaggggggacacatctgtgaacctcgaagagcagggtagaaaaccaggttcccctccctgctcgctgtctcttttctctccgggaggcactcttgggtcttctgcactctaaaccatgctcactaggagtctgctggcctttgcactagatgttagtttgagcccttgtctggtatcccacaaggattcctgcaacccacacactgggcttatggccagctcaaaataagtgctcttgggggtctctgccctttcacttcttctcctggtgcttcctggcctttgacctctgcttgcttggccaaccctcttttcacccggtggagttctgagtggaagcttatgtgaagacacacacacagactcttgggccctttctcccctcatccagctgcccattcctggatgagtaggagccaaggttagggacactgtcccactgtcccactgtccccaacggagtggataatgcactacttgctcctggggacactttccagagttggcttatgtcctccagcttggtgtccacatataacatgctaggatgttaggggaggcagagagggattcggagaaggggagcagcaggaagagagagaccttggaaagcctcagctatgagaaactgggagtgaagggtttggagagggccggggcgcgggccacctacactgctccttggcccagcctgcccagtgcaagtgcagaccttggggagggctctgtcggcaggagccatacgaacgccctcacgtcagtcacgacaccctgtgctttaggttttgtttcgtttgtttgtttttctgttgtagctttttttccttttttgtcctgttacattttgttttgcctgttcgtatcttagaaggggggaaagttgtaattatttcatctaaatctcccattatatatctgtgaataagagattctatgatagcagaaggatgtatattttagcttgtcatgacgtgtcatgataacgaaggacactgagaaagaggatagtccagagccccgttcttgtgaatgttttgtgtttgttttgacatgtgtgtttggtttgggtttttttgtttttgttgtttttgagctgcactgagcagggtgctgggcaggctggggcatgggcacctctgcaggagactggacaccgactaaggactgggggcctgagatcagctgtgaacatttgcagcacaatgcatgcaagtcagggatgtgggggtcccacagccagcagcaccccctgatggaacaactgtacatttgccaatgggttttccccacaagactacggtttttactacaaataaacttacgttctattctgca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]