GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-14 16:22:04, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_001106314             672 bp    mRNA    linear   ROD 22-MAR-2023
DEFINITION  Rattus norvegicus interferon induced transmembrane protein 1
            (Ifitm1), mRNA.
ACCESSION   NM_001106314 XM_001059109 XM_001059158 XM_215117
VERSION     NM_001106314.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Li D, Yang Z, Liu Z, Zou Q and Yuan Y.
  TITLE     DDR2 and IFITM1 Are Prognostic Markers in Gallbladder Squamous
            Cell/Adenosquamous Carcinomas and Adenocarcinomas
  JOURNAL   Pathol Oncol Res 25 (1), 157-167 (2019)
   PUBMED   29043607
REFERENCE   2  (bases 1 to 672)
  AUTHORS   Wang Y, Lin YH, Wu Y, Yao ZF, Tang J, Shen L, Wang R, Ding SQ, Hu
            JG and Lu HZ.
  TITLE     Expression and Cellular Localization of IFITM1 in Normal and
            Injured Rat Spinal Cords
  JOURNAL   J Histochem Cytochem 66 (3), 175-187 (2018)
   PUBMED   29300519
  REMARK    GeneRIF: These results demonstrate that IFITM1 is mainly expressed
            in astrocytes and oligodendroglia in normal spinal cords, and could
            rapidly increase in infiltrated leukocytes, activated microglia,
            and astrocytes after spinal cord injury.
REFERENCE   3  (bases 1 to 672)
  AUTHORS   Jia R, Ding S, Pan Q, Liu SL, Qiao W and Liang C.
  TITLE     The C-terminal sequence of IFITM1 regulates its anti-HIV-1 activity
  JOURNAL   PLoS One 10 (3), e0118794 (2015)
   PUBMED   25738301
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 672)
  AUTHORS   Lau SL, Yuen ML, Kou CY, Au KW, Zhou J and Tsui SK.
  TITLE     Interferons induce the expression of IFITM1 and IFITM3 and suppress
            the proliferation of rat neonatal cardiomyocytes
  JOURNAL   J Cell Biochem 113 (3), 841-847 (2012)
   PUBMED   22021094
  REMARK    GeneRIF: Up-regulation of IFITM1 was observed during the heart
            development of Sprague-Dawley rats and the differentiation of H9C2
            cells
REFERENCE   5  (bases 1 to 672)
  AUTHORS   Zhang Z, Liu J, Li M, Yang H and Zhang C.
  TITLE     Evolutionary dynamics of the interferon-induced transmembrane gene
            family in vertebrates
  JOURNAL   PLoS One 7 (11), e49265 (2012)
   PUBMED   23166625
REFERENCE   6  (bases 1 to 672)
  AUTHORS   Huang IC, Bailey CC, Weyer JL, Radoshitzky SR, Becker MM, Chiang
            JJ, Brass AL, Ahmed AA, Chi X, Dong L, Longobardi LE, Boltz D, Kuhn
            JH, Elledge SJ, Bavari S, Denison MR, Choe H and Farzan M.
  TITLE     Distinct patterns of IFITM-mediated restriction of filoviruses,
            SARS coronavirus, and influenza A virus
  JOURNAL   PLoS Pathog 7 (1), e1001258 (2011)
   PUBMED   21253575
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 672)
  AUTHORS   Brass AL, Huang IC, Benita Y, John SP, Krishnan MN, Feeley EM, Ryan
            BJ, Weyer JL, van der Weyden L, Fikrig E, Adams DJ, Xavier RJ,
            Farzan M and Elledge SJ.
  TITLE     The IFITM proteins mediate cellular resistance to influenza A H1N1
            virus, West Nile virus, and dengue virus
  JOURNAL   Cell 139 (7), 1243-1254 (2009)
   PUBMED   20064371
REFERENCE   8  (bases 1 to 672)
  AUTHORS   Lickert H, Cox B, Wehrle C, Taketo MM, Kemler R and Rossant J.
  TITLE     Dissecting Wnt/beta-catenin signaling during gastrulation using RNA
            interference in mouse embryos
  JOURNAL   Development 132 (11), 2599-2609 (2005)
   PUBMED   15857914
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CH473953.1.
            
            On or before Oct 4, 2007 this sequence version replaced
            XM_001059109.1, XM_215117.4, XM_001059158.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CB812207.1, CO557795.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..672
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q41"
     gene            1..672
                     /gene="Ifitm1"
                     /note="interferon induced transmembrane protein 1"
                     /db_xref="GeneID:293618"
                     /db_xref="RGD:1307601"
     exon            1..146
                     /gene="Ifitm1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    121..123
                     /gene="Ifitm1"
                     /note="upstream in-frame stop codon"
     exon            147..348
                     /gene="Ifitm1"
                     /inference="alignment:Splign:2.1.0"
     CDS             163..492
                     /gene="Ifitm1"
                     /codon_start=1
                     /product="interferon-induced transmembrane protein 1"
                     /protein_id="NP_001099784.1"
                     /db_xref="GeneID:293618"
                     /db_xref="RGD:1307601"
                     /translation="
MPKEQQEVVILGGPHTSNSATTTTINMPAEISTPDHVVWSLFNTLFMNFCCLGFIAYSYSVKSRDRKMVGDVTGAKTYASTAKCLNISSVIFTILMAILTIILYATKRT"
     misc_feature    262..459
                     /gene="Ifitm1"
                     /note="Interferon-induced transmembrane protein; Region:
                     CD225; pfam04505"
                     /db_xref="CDD:461336"
     exon            349..672
                     /gene="Ifitm1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
caggatcccagcgtaccttctagaacctccctgggaccctagcaccaaattgagacagctgtttttagtcttgtggacgactcctagatcctgggcctttctgtcaggagacggccattgtagggctcctcggaccaagcctgtatcctcaaaagccaagagatgcccaaggaacagcaagaggtggttatcctgggaggaccccacacctcaaattctgcgacaaccaccacaatcaacatgcctgctgagatctccacgcctgaccacgtggtctggtccctgttcaatacgctcttcatgaacttctgctgcctgggcttcatagcgtattcctactctgtgaagtctagggacaggaagatggtgggtgatgtgactggggccaagacctacgcctccactgccaagtgcctgaacatcagctccgtgatttttaccatcctcatggctatcctcacgatcattctttacgccactaaaagaacatagccatcttgcagcacctcacggtagataacagattctggggccttccagtctgccccaaactctagtcttagtcctgcctgtttaccccacacatatgcaaatgttatactcacatggctgttcatagtggattcaataaaatacatgtgctgcgaccttctgtccctggactaaccctgt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]