2025-07-16 04:11:41, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001106314 672 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus interferon induced transmembrane protein 1 (Ifitm1), mRNA. ACCESSION NM_001106314 XM_001059109 XM_001059158 XM_215117 VERSION NM_001106314.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 672) AUTHORS Li D, Yang Z, Liu Z, Zou Q and Yuan Y. TITLE DDR2 and IFITM1 Are Prognostic Markers in Gallbladder Squamous Cell/Adenosquamous Carcinomas and Adenocarcinomas JOURNAL Pathol Oncol Res 25 (1), 157-167 (2019) PUBMED 29043607 REFERENCE 2 (bases 1 to 672) AUTHORS Wang Y, Lin YH, Wu Y, Yao ZF, Tang J, Shen L, Wang R, Ding SQ, Hu JG and Lu HZ. TITLE Expression and Cellular Localization of IFITM1 in Normal and Injured Rat Spinal Cords JOURNAL J Histochem Cytochem 66 (3), 175-187 (2018) PUBMED 29300519 REMARK GeneRIF: These results demonstrate that IFITM1 is mainly expressed in astrocytes and oligodendroglia in normal spinal cords, and could rapidly increase in infiltrated leukocytes, activated microglia, and astrocytes after spinal cord injury. REFERENCE 3 (bases 1 to 672) AUTHORS Jia R, Ding S, Pan Q, Liu SL, Qiao W and Liang C. TITLE The C-terminal sequence of IFITM1 regulates its anti-HIV-1 activity JOURNAL PLoS One 10 (3), e0118794 (2015) PUBMED 25738301 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 672) AUTHORS Lau SL, Yuen ML, Kou CY, Au KW, Zhou J and Tsui SK. TITLE Interferons induce the expression of IFITM1 and IFITM3 and suppress the proliferation of rat neonatal cardiomyocytes JOURNAL J Cell Biochem 113 (3), 841-847 (2012) PUBMED 22021094 REMARK GeneRIF: Up-regulation of IFITM1 was observed during the heart development of Sprague-Dawley rats and the differentiation of H9C2 cells REFERENCE 5 (bases 1 to 672) AUTHORS Zhang Z, Liu J, Li M, Yang H and Zhang C. TITLE Evolutionary dynamics of the interferon-induced transmembrane gene family in vertebrates JOURNAL PLoS One 7 (11), e49265 (2012) PUBMED 23166625 REFERENCE 6 (bases 1 to 672) AUTHORS Huang IC, Bailey CC, Weyer JL, Radoshitzky SR, Becker MM, Chiang JJ, Brass AL, Ahmed AA, Chi X, Dong L, Longobardi LE, Boltz D, Kuhn JH, Elledge SJ, Bavari S, Denison MR, Choe H and Farzan M. TITLE Distinct patterns of IFITM-mediated restriction of filoviruses, SARS coronavirus, and influenza A virus JOURNAL PLoS Pathog 7 (1), e1001258 (2011) PUBMED 21253575 REMARK Publication Status: Online-Only REFERENCE 7 (bases 1 to 672) AUTHORS Brass AL, Huang IC, Benita Y, John SP, Krishnan MN, Feeley EM, Ryan BJ, Weyer JL, van der Weyden L, Fikrig E, Adams DJ, Xavier RJ, Farzan M and Elledge SJ. TITLE The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus JOURNAL Cell 139 (7), 1243-1254 (2009) PUBMED 20064371 REFERENCE 8 (bases 1 to 672) AUTHORS Lickert H, Cox B, Wehrle C, Taketo MM, Kemler R and Rossant J. TITLE Dissecting Wnt/beta-catenin signaling during gastrulation using RNA interference in mouse embryos JOURNAL Development 132 (11), 2599-2609 (2005) PUBMED 15857914 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CH473953.1. On or before Oct 4, 2007 this sequence version replaced XM_001059109.1, XM_215117.4, XM_001059158.1. ##Evidence-Data-START## Transcript exon combination :: CB812207.1, CO557795.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760383 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..672 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q41" gene 1..672 /gene="Ifitm1" /note="interferon induced transmembrane protein 1" /db_xref="GeneID:293618" /db_xref="RGD:1307601" exon 1..146 /gene="Ifitm1" /inference="alignment:Splign:2.1.0" misc_feature 121..123 /gene="Ifitm1" /note="upstream in-frame stop codon" exon 147..348 /gene="Ifitm1" /inference="alignment:Splign:2.1.0" CDS 163..492 /gene="Ifitm1" /codon_start=1 /product="interferon-induced transmembrane protein 1" /protein_id="NP_001099784.1" /db_xref="GeneID:293618" /db_xref="RGD:1307601" /translation="
MPKEQQEVVILGGPHTSNSATTTTINMPAEISTPDHVVWSLFNTLFMNFCCLGFIAYSYSVKSRDRKMVGDVTGAKTYASTAKCLNISSVIFTILMAILTIILYATKRT"
misc_feature 262..459 /gene="Ifitm1" /note="Interferon-induced transmembrane protein; Region: CD225; pfam04505" /db_xref="CDD:461336" exon 349..672 /gene="Ifitm1" /inference="alignment:Splign:2.1.0" ORIGIN
caggatcccagcgtaccttctagaacctccctgggaccctagcaccaaattgagacagctgtttttagtcttgtggacgactcctagatcctgggcctttctgtcaggagacggccattgtagggctcctcggaccaagcctgtatcctcaaaagccaagagatgcccaaggaacagcaagaggtggttatcctgggaggaccccacacctcaaattctgcgacaaccaccacaatcaacatgcctgctgagatctccacgcctgaccacgtggtctggtccctgttcaatacgctcttcatgaacttctgctgcctgggcttcatagcgtattcctactctgtgaagtctagggacaggaagatggtgggtgatgtgactggggccaagacctacgcctccactgccaagtgcctgaacatcagctccgtgatttttaccatcctcatggctatcctcacgatcattctttacgccactaaaagaacatagccatcttgcagcacctcacggtagataacagattctggggccttccagtctgccccaaactctagtcttagtcctgcctgtttaccccacacatatgcaaatgttatactcacatggctgttcatagtggattcaataaaatacatgtgctgcgaccttctgtccctggactaaccctgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]