2024-05-04 23:59:39, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001103359 1935 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus carboxylesterase 1F (Ces1f), mRNA. ACCESSION NM_001103359 VERSION NM_001103359.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1935) AUTHORS Parathath S, Dogan S, Joaquin VA, Ghosh S, Guo L, Weibel GL, Rothblat GH, Harrison EH and Fisher EA. TITLE Rat carboxylesterase ES-4 enzyme functions as a major hepatic neutral cholesteryl ester hydrolase JOURNAL J Biol Chem 286 (46), 39683-39692 (2011) PUBMED 21937439 REMARK GeneRIF: establish ES-4 as a bona fide endogenous nCEH that can account for the majority of cholesteryl ester hydrolysis in transformed rat hepatic cells and primary rat hepatocytes. REFERENCE 2 (bases 1 to 1935) AUTHORS Holmes RS, Wright MW, Laulederkind SJ, Cox LA, Hosokawa M, Imai T, Ishibashi S, Lehner R, Miyazaki M, Perkins EJ, Potter PM, Redinbo MR, Robert J, Satoh T, Yamashita T, Yan B, Yokoi T, Zechner R and Maltais LJ. TITLE Recommended nomenclature for five mammalian carboxylesterase gene families: human, mouse, and rat genes and proteins JOURNAL Mamm Genome 21 (9-10), 427-441 (2010) PUBMED 20931200 REFERENCE 3 (bases 1 to 1935) AUTHORS Sanghani SP, Davis WI, Dumaual NG, Mahrenholz A and Bosron WF. TITLE Identification of microsomal rat liver carboxylesterases and their activity with retinyl palmitate JOURNAL Eur J Biochem 269 (18), 4387-4398 (2002) PUBMED 12230550 REFERENCE 4 (bases 1 to 1935) AUTHORS Robbi M, Van Schaftingen E and Beaufay H. TITLE Cloning and sequencing of rat liver carboxylesterase ES-4 (microsomal palmitoyl-CoA hydrolase) JOURNAL Biochem J 313 (Pt 3) (Pt 3), 821-826 (1996) PUBMED 8611161 REFERENCE 5 (bases 1 to 1935) AUTHORS Yan B, Yang D, Brady M and Parkinson A. TITLE Rat kidney carboxylesterase. Cloning, sequencing, cellular localization, and relationship to rat liver hydrolase JOURNAL J Biol Chem 269 (47), 29688-29696 (1994) PUBMED 7961958 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from FM041665.1 and BC128711.1. On May 9, 2012 this sequence version replaced NM_001103359.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMEA5756307, SAMEA5760400 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-535 FM041665.1 1-535 536-1935 BC128711.1 518-1917 FEATURES Location/Qualifiers source 1..1935 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="19" /map="19p11" gene 1..1935 /gene="Ces1f" /note="carboxylesterase 1F" /db_xref="GeneID:100125372" /db_xref="RGD:1642419" exon 1..86 /gene="Ces1f" /inference="alignment:Splign:2.1.0" CDS 35..1720 /gene="Ces1f" /EC_number="3.1.1.1" /note="liver carboxylesterase 4; carboxylesterase ES-4; carboxyesterase ES-4; kidney microsomal carboxylesterase; microsomal palmitoyl-CoA hydrolase; liver carboxylesterase 1F" /codon_start=1 /product="liver carboxylesterase 1F precursor" /protein_id="NP_001096829.2" /db_xref="GeneID:100125372" /db_xref="RGD:1642419" /translation="
MCLSFLFLVSLATCVVYGNPSSPPVVDTTKGKVLGKYVSLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDAAKGQRMNDLLTNRKEKIHLEFSEDCLYLNIYTPADFTKNSRLPVMVWIHGGGMTLGGASTYDGRVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLTKNLFHRAISESGVVFLPGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKMNLIKLSSQRDNKESYHFLSTVVDNVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMGFVPADVELDKKMAITLLEKFASLYGIPEDIIPVAIEKYRKGSDDSIKIRDGILAFIGDVSFSIPSVMVSRDHRDAGAPTYMYEYQYYPSFSSPQRPKHVVGDHADDLYSVFGAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLAKRQPQPHHNEL"
sig_peptide 35..88 /gene="Ces1f" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 98..1669 /gene="Ces1f" /note="Carboxylesterase family; Region: COesterase; pfam00135" /db_xref="CDD:395084" misc_feature 269..271 /gene="Ces1f" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q64573.2); glycosylation site" misc_feature order(455..463,692..700,707..709,1178..1180,1187..1192, 1289..1291,1433..1435,1442..1444) /gene="Ces1f" /note="substrate binding pocket [chemical binding]; other site" /db_xref="CDD:238191" misc_feature order(695..697,1091..1093,1430..1432) /gene="Ces1f" /note="catalytic triad [active]" /db_xref="CDD:238191" misc_feature 1706..1717 /gene="Ces1f" /note="propagated from UniProtKB/Swiss-Prot (Q64573.2); Region: Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138" exon 87..291 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 292..436 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 437..570 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 571..724 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 725..829 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 830..934 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 935..973 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 974..1114 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 1115..1195 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 1196..1343 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 1344..1475 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 1476..1548 /gene="Ces1f" /inference="alignment:Splign:2.1.0" exon 1549..1910 /gene="Ces1f" /inference="alignment:Splign:2.1.0" ORIGIN
aaactctactgactggagcacctgtccatgcaagatgtgcctcagcttcctgttcctggtgtccctagcaacctgtgtggtttatggaaacccctcttcaccacccgtggtggacaccacgaaaggcaaagtcctggggaagtacgtcagcttagaaggagtcacacagtctgtagctgtcttcctgggagtcccttttgccaagccccctctgggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtgaagaacaccaccacctatccacctatgtgctctcaagatgcagcaaaagggcagaggatgaatgatctcctaaccaacagaaaggagaaaatccatctcgagttttctgaagattgtctctacctgaatatttacactcctgcagactttacaaagaatagcaggctgccagtgatggtgtggatccatggaggtggaatgacactgggcggggcatcaacctatgatggccgggtcctctctgcctatgaaaacgtggtggtagtggccattcagtatcgcctgggcatctggggattcttcagcacaggggatgaacacagcaggggaaactggggtcatttggaccaagtggctgcgctgcactgggtccaggacaacattgccaactttgggggtgacccaggctctgtgaccatctttggagagtcagcaggaggtttcagtgtctctgttcttgtgttgtccccactgaccaagaacctcttccacagggccatttctgagagtggggtggtcttccttcctggattgttaaccaaggatgttagaccagccgctaagcaaattgctgatatggctggatgtgaaaccaccacatctgccatcattgttcactgcctgcgtcaaaagacagaagaggagctcttagagattatgaagaaaatgaatctgattaaactcagttcacaaagggataacaaagagagctaccactttttgtcaactgtggttgacaatgtagtgctgccgaaggacccaaaagagatcctggctgagaagaacttcaacaccgtgccctacattgtgggaatcaacaagcaagaatgtggctggcttctgccaacaatgatgggatttgtaccagctgatgtagaattggacaagaagatggccattacgctcctggagaaatttgcttccctatatggtataccagaggatattattccagttgccattgagaagtacagaaaaggtagtgatgactccatcaagatcagagatggaatccttgcctttattggggatgtgtcattttctatcccatcagtgatggtgtcccgtgaccacagagatgctggagctcccacctacatgtatgagtatcaatactacccgagcttctcatcaccccaaagacccaagcatgtagtaggagaccatgcagatgatctctactctgtctttggtgccccaattttaagagatggtgcctcagaagaggagatcaagctcagcaagatggtgatgaaattttgggccaactttgctcggaatgggaaccctaatggccgagggctacctcattggccacagtatgaccagaaagaagaatatctgcagattggtgccaccacccagcaatcgcagagactgaaagcagaggaagtggctttttggacacagttactggctaagagacaacctcagccacaccacaacgagctgtgaatgcaagtctctgtcatcttcagaacaagcaagccaagatatagttcttccactaaagatgtatgtaaatggaagatggatctggaggatcctgaagaattttgtcaaagagacagggagaacccaggaaagagaaatatttgtacttatggcaccaatttagagaataaatgacatttttacggtcaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]