GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-02 04:59:20, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001103359            1935 bp    mRNA    linear   ROD 21-MAR-2023
DEFINITION  Rattus norvegicus carboxylesterase 1F (Ces1f), mRNA.
ACCESSION   NM_001103359
VERSION     NM_001103359.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1935)
  AUTHORS   Parathath S, Dogan S, Joaquin VA, Ghosh S, Guo L, Weibel GL,
            Rothblat GH, Harrison EH and Fisher EA.
  TITLE     Rat carboxylesterase ES-4 enzyme functions as a major hepatic
            neutral cholesteryl ester hydrolase
  JOURNAL   J Biol Chem 286 (46), 39683-39692 (2011)
   PUBMED   21937439
  REMARK    GeneRIF: establish ES-4 as a bona fide endogenous nCEH that can
            account for the majority of cholesteryl ester hydrolysis in
            transformed rat hepatic cells and primary rat hepatocytes.
REFERENCE   2  (bases 1 to 1935)
  AUTHORS   Holmes RS, Wright MW, Laulederkind SJ, Cox LA, Hosokawa M, Imai T,
            Ishibashi S, Lehner R, Miyazaki M, Perkins EJ, Potter PM, Redinbo
            MR, Robert J, Satoh T, Yamashita T, Yan B, Yokoi T, Zechner R and
            Maltais LJ.
  TITLE     Recommended nomenclature for five mammalian carboxylesterase gene
            families: human, mouse, and rat genes and proteins
  JOURNAL   Mamm Genome 21 (9-10), 427-441 (2010)
   PUBMED   20931200
REFERENCE   3  (bases 1 to 1935)
  AUTHORS   Sanghani SP, Davis WI, Dumaual NG, Mahrenholz A and Bosron WF.
  TITLE     Identification of microsomal rat liver carboxylesterases and their
            activity with retinyl palmitate
  JOURNAL   Eur J Biochem 269 (18), 4387-4398 (2002)
   PUBMED   12230550
REFERENCE   4  (bases 1 to 1935)
  AUTHORS   Robbi M, Van Schaftingen E and Beaufay H.
  TITLE     Cloning and sequencing of rat liver carboxylesterase ES-4
            (microsomal palmitoyl-CoA hydrolase)
  JOURNAL   Biochem J 313 (Pt 3) (Pt 3), 821-826 (1996)
   PUBMED   8611161
REFERENCE   5  (bases 1 to 1935)
  AUTHORS   Yan B, Yang D, Brady M and Parkinson A.
  TITLE     Rat kidney carboxylesterase. Cloning, sequencing, cellular
            localization, and relationship to rat liver hydrolase
  JOURNAL   J Biol Chem 269 (47), 29688-29696 (1994)
   PUBMED   7961958
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from FM041665.1 and
            BC128711.1.
            
            On May 9, 2012 this sequence version replaced NM_001103359.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMEA5756307,
                              SAMEA5760400 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-535               FM041665.1         1-535
            536-1935            BC128711.1         518-1917
FEATURES             Location/Qualifiers
     source          1..1935
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="19"
                     /map="19p11"
     gene            1..1935
                     /gene="Ces1f"
                     /note="carboxylesterase 1F"
                     /db_xref="GeneID:100125372"
                     /db_xref="RGD:1642419"
     exon            1..86
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     CDS             35..1720
                     /gene="Ces1f"
                     /EC_number="3.1.1.1"
                     /note="liver carboxylesterase 4; carboxylesterase ES-4;
                     carboxyesterase ES-4; kidney microsomal carboxylesterase;
                     microsomal palmitoyl-CoA hydrolase; liver carboxylesterase
                     1F"
                     /codon_start=1
                     /product="liver carboxylesterase 1F precursor"
                     /protein_id="NP_001096829.2"
                     /db_xref="GeneID:100125372"
                     /db_xref="RGD:1642419"
                     /translation="
MCLSFLFLVSLATCVVYGNPSSPPVVDTTKGKVLGKYVSLEGVTQSVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTTYPPMCSQDAAKGQRMNDLLTNRKEKIHLEFSEDCLYLNIYTPADFTKNSRLPVMVWIHGGGMTLGGASTYDGRVLSAYENVVVVAIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGFSVSVLVLSPLTKNLFHRAISESGVVFLPGLLTKDVRPAAKQIADMAGCETTTSAIIVHCLRQKTEEELLEIMKKMNLIKLSSQRDNKESYHFLSTVVDNVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMMGFVPADVELDKKMAITLLEKFASLYGIPEDIIPVAIEKYRKGSDDSIKIRDGILAFIGDVSFSIPSVMVSRDHRDAGAPTYMYEYQYYPSFSSPQRPKHVVGDHADDLYSVFGAPILRDGASEEEIKLSKMVMKFWANFARNGNPNGRGLPHWPQYDQKEEYLQIGATTQQSQRLKAEEVAFWTQLLAKRQPQPHHNEL"
     sig_peptide     35..88
                     /gene="Ces1f"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    98..1669
                     /gene="Ces1f"
                     /note="Carboxylesterase family; Region: COesterase;
                     pfam00135"
                     /db_xref="CDD:395084"
     misc_feature    269..271
                     /gene="Ces1f"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q64573.2); glycosylation site"
     misc_feature    order(455..463,692..700,707..709,1178..1180,1187..1192,
                     1289..1291,1433..1435,1442..1444)
                     /gene="Ces1f"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238191"
     misc_feature    order(695..697,1091..1093,1430..1432)
                     /gene="Ces1f"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238191"
     misc_feature    1706..1717
                     /gene="Ces1f"
                     /note="propagated from UniProtKB/Swiss-Prot (Q64573.2);
                     Region: Prevents secretion from ER.
                     /evidence=ECO:0000255|PROSITE-ProRule:PRU10138"
     exon            87..291
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            292..436
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            437..570
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            571..724
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            725..829
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            830..934
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            935..973
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            974..1114
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            1115..1195
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            1196..1343
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            1344..1475
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            1476..1548
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
     exon            1549..1910
                     /gene="Ces1f"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
aaactctactgactggagcacctgtccatgcaagatgtgcctcagcttcctgttcctggtgtccctagcaacctgtgtggtttatggaaacccctcttcaccacccgtggtggacaccacgaaaggcaaagtcctggggaagtacgtcagcttagaaggagtcacacagtctgtagctgtcttcctgggagtcccttttgccaagccccctctgggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtgaagaacaccaccacctatccacctatgtgctctcaagatgcagcaaaagggcagaggatgaatgatctcctaaccaacagaaaggagaaaatccatctcgagttttctgaagattgtctctacctgaatatttacactcctgcagactttacaaagaatagcaggctgccagtgatggtgtggatccatggaggtggaatgacactgggcggggcatcaacctatgatggccgggtcctctctgcctatgaaaacgtggtggtagtggccattcagtatcgcctgggcatctggggattcttcagcacaggggatgaacacagcaggggaaactggggtcatttggaccaagtggctgcgctgcactgggtccaggacaacattgccaactttgggggtgacccaggctctgtgaccatctttggagagtcagcaggaggtttcagtgtctctgttcttgtgttgtccccactgaccaagaacctcttccacagggccatttctgagagtggggtggtcttccttcctggattgttaaccaaggatgttagaccagccgctaagcaaattgctgatatggctggatgtgaaaccaccacatctgccatcattgttcactgcctgcgtcaaaagacagaagaggagctcttagagattatgaagaaaatgaatctgattaaactcagttcacaaagggataacaaagagagctaccactttttgtcaactgtggttgacaatgtagtgctgccgaaggacccaaaagagatcctggctgagaagaacttcaacaccgtgccctacattgtgggaatcaacaagcaagaatgtggctggcttctgccaacaatgatgggatttgtaccagctgatgtagaattggacaagaagatggccattacgctcctggagaaatttgcttccctatatggtataccagaggatattattccagttgccattgagaagtacagaaaaggtagtgatgactccatcaagatcagagatggaatccttgcctttattggggatgtgtcattttctatcccatcagtgatggtgtcccgtgaccacagagatgctggagctcccacctacatgtatgagtatcaatactacccgagcttctcatcaccccaaagacccaagcatgtagtaggagaccatgcagatgatctctactctgtctttggtgccccaattttaagagatggtgcctcagaagaggagatcaagctcagcaagatggtgatgaaattttgggccaactttgctcggaatgggaaccctaatggccgagggctacctcattggccacagtatgaccagaaagaagaatatctgcagattggtgccaccacccagcaatcgcagagactgaaagcagaggaagtggctttttggacacagttactggctaagagacaacctcagccacaccacaacgagctgtgaatgcaagtctctgtcatcttcagaacaagcaagccaagatatagttcttccactaaagatgtatgtaaatggaagatggatctggaggatcctgaagaattttgtcaaagagacagggagaacccaggaaagagaaatatttgtacttatggcaccaatttagagaataaatgacatttttacggtcaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]