2024-05-03 01:20:54, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001081660 618 bp mRNA linear ROD 22-MAR-2023 DEFINITION Rattus norvegicus crystallin, gamma C (Crygc), transcript variant 2, mRNA. ACCESSION NM_001081660 VERSION NM_001081660.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 618) AUTHORS Yao K, Jin C, Zhu N, Wang W, Wu R, Jiang J and Shentu X. TITLE A nonsense mutation in CRYGC associated with autosomal dominant congenital nuclear cataract in a Chinese family JOURNAL Mol Vis 14, 1272-1276 (2008) PUBMED 18618005 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 618) AUTHORS Muller C, Wohlke A and Distl O. TITLE Evaluation of three canine gamma-crystallins (CRYGB, CRYGC, and CRYGS) as candidates for hereditary cataracts in the dachshund JOURNAL Mol Vis 13, 125-132 (2007) PUBMED 17327821 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 618) AUTHORS Organisciak D, Darrow R, Gu X, Barsalou L and Crabb JW. TITLE Genetic, age and light mediated effects on crystallin protein expression in the retina JOURNAL Photochem Photobiol 82 (4), 1088-1096 (2006) PUBMED 16602829 REFERENCE 4 (bases 1 to 618) AUTHORS Pigaga V and Quinlan RA. TITLE Lenticular chaperones suppress the aggregation of the cataract-causing mutant T5P gamma C-crystallin JOURNAL Exp Cell Res 312 (1), 51-62 (2006) PUBMED 16303126 REFERENCE 5 (bases 1 to 618) AUTHORS Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J. TITLE Genetic and allelic heterogeneity of Cryg mutations in eight distinct forms of dominant cataract in the mouse JOURNAL Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004) PUBMED 15037589 REFERENCE 6 (bases 1 to 618) AUTHORS Szpirer C, Szpirer J, Van Vooren P, Tissir F, Simon JS, Koike G, Jacob HJ, Lander ES, Helou K, Klinga-Levan K and Levan G. TITLE Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution JOURNAL Mamm Genome 9 (9), 721-734 (1998) PUBMED 9716657 REFERENCE 7 (bases 1 to 618) AUTHORS Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De Jong WW. TITLE Differential synthesis of crystallins in the developing rat eye lens JOURNAL Exp Eye Res 50 (4), 429-437 (1990) PUBMED 2338125 REFERENCE 8 (bases 1 to 618) AUTHORS den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers JG. TITLE Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region JOURNAL Gene 78 (2), 201-213 (1989) PUBMED 2777080 REFERENCE 9 (bases 1 to 618) AUTHORS den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G. TITLE Concerted and divergent evolution within the rat gamma-crystallin gene family JOURNAL J Mol Biol 189 (1), 37-46 (1986) PUBMED 3783678 REFERENCE 10 (bases 1 to 618) AUTHORS Moormann,R.J., den Dunnen,J.T., Bloemendal,H. and Schoenmakers,J.G. TITLE Extensive intragenic sequence homology in two distinct rat lens gamma-crystallin cDNAs suggests duplications of a primordial gene JOURNAL Proc Natl Acad Sci U S A 79 (22), 6876-6880 (1982) PUBMED 6294661 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from M19359.1. On or before Feb 24, 2007 this sequence version replaced XM_217421.4, XM_001072315.1. Transcript Variant: This variant (2) uses an alternate splice site in the coding region compared to variant 1. The resulting protein (isoform 2) is shorter but has the same N- and C-termini compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..618 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="9" /map="9q32" gene 1..618 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="crystallin, gamma C" /db_xref="GeneID:24277" /db_xref="RGD:2421" exon 1..36 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /inference="alignment:Splign:2.1.0" CDS 28..552 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="isoform 2 is encoded by transcript variant 2; gamma-crystallin C; gamma-C-crystallin; gamma-crystallin 2-1; crystallin, gamma polypeptide 3" /codon_start=1 /product="gamma-crystallin C isoform 2" /protein_id="NP_001075129.1" /db_xref="GeneID:24277" /db_xref="RGD:2421" /translation="
MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSIRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPHTGSHRMRLYEKEDHKGVMMELSEDCSCIQDRFHLSEVRSLHVLEGCWVLYEMPNYRGRQYLLRPQEYRRYHDWGAVDAKAGSLRRVVDLY"
misc_feature 34..273 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="Beta/gamma crystallins; Region: XTALbg; smart00247" /db_xref="CDD:214583" misc_feature 94..96 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="S-methylcysteine. /evidence=ECO:0000250; propagated from UniProtKB/Swiss-Prot (P02529.4); methylation site" misc_feature 277..288 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="propagated from UniProtKB/Swiss-Prot (P02529.4); Region: Connecting peptide" misc_feature 292..537 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /note="Beta/Gamma crystallin; Region: Crystall; pfam00030" /db_xref="CDD:425430" exon 37..279 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /inference="alignment:Splign:2.1.0" exon 280..618 /gene="Crygc" /gene_synonym="Cryg; Cryg3; Len" /inference="alignment:Splign:2.1.0" ORIGIN
actgaactcaccacgggtcagccagccatggggaagatcaccttctacgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccatccgcgtggacagtggctgctggatgctctatgagcgccccaactaccagggccaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgcctcatcccccatacaggttcccacaggatgcgtctgtatgagaaagaagatcacaaaggcgtcatgatggagctgagtgaagactgctcctgcatccaggaccgcttccacctcagtgaggtgcgctcgctgcacgtgctagagggctgctgggtcctctatgagatgcctaactaccgaggccggcagtatctgctgaggcctcaagagtaccggcgctaccacgactggggcgctgtagatgctaaggcaggctctttgcggagggtggtagatttatactaaaataggtgaacgctaccattttctcattttggaacctaataaagtatttagtctgtattgttggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]