2024-05-01 05:54:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001080936 618 bp mRNA linear ROD 17-JUL-2023 DEFINITION Rattus norvegicus crystallin, gamma A (Cryga), mRNA. ACCESSION NM_001080936 XM_001066957 XM_001067011 VERSION NM_001080936.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 618) AUTHORS Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J. TITLE Genetic and allelic heterogeneity of Cryg mutations in eight distinct forms of dominant cataract in the mouse JOURNAL Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004) PUBMED 15037589 REFERENCE 2 (bases 1 to 618) AUTHORS Everett CA, Glenister PH, Taylor DM, Lyon MF, Kratochvilova-Loester J and Favor J. TITLE Mapping of six dominant cataract genes in the mouse JOURNAL Genomics 20 (3), 429-434 (1994) PUBMED 8034315 REFERENCE 3 (bases 1 to 618) AUTHORS Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De Jong WW. TITLE Differential synthesis of crystallins in the developing rat eye lens JOURNAL Exp Eye Res 50 (4), 429-437 (1990) PUBMED 2338125 REFERENCE 4 (bases 1 to 618) AUTHORS den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers JG. TITLE Nucleotide sequence of the rat gamma-crystallin gene region and comparison with an orthologous human region JOURNAL Gene 78 (2), 201-213 (1989) PUBMED 2777080 REFERENCE 5 (bases 1 to 618) AUTHORS den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G. TITLE Concerted and divergent evolution within the rat gamma-crystallin gene family JOURNAL J Mol Biol 189 (1), 37-46 (1986) PUBMED 3783678 REFERENCE 6 (bases 1 to 618) AUTHORS Favor,J. TITLE Characterization of dominant cataract mutations in mice: penetrance, fertility and homozygous viability of mutations recovered after 250 mg/kg ethylnitrosourea paternal treatment JOURNAL Genet Res 44 (2), 183-197 (1984) PUBMED 6510713 REFERENCE 7 (bases 1 to 618) AUTHORS Favor,J. TITLE A comparison of the dominant cataract and recessive specific-locus mutation rates induced by treatment of male mice with ethylnitrosourea JOURNAL Mutat Res 110 (2), 367-382 (1983) PUBMED 6877261 REFERENCE 8 (bases 1 to 618) AUTHORS Ehling,U.H., Favor,J., Kratochvilova,J. and Neuhauser-Klaus,A. TITLE Dominant cataract mutations and specific-locus mutations in mice induced by radiation or ethylnitrosourea JOURNAL Mutat Res 92 (1-2), 181-192 (1982) PUBMED 7088001 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000214.1. On Nov 10, 2022 this sequence version replaced NM_001080936.1. ##Evidence-Data-START## RNAseq introns :: mixed sample support SAMEA5760396, SAMN06680452 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 JACYVU010000214.1 22479488-22479529 c 43-285 JACYVU010000214.1 22479145-22479387 c 286-618 JACYVU010000214.1 22477067-22477399 c FEATURES Location/Qualifiers source 1..618 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="9" /map="9q32" gene 1..618 /gene="Cryga" /note="crystallin, gamma A" /db_xref="GeneID:684028" /db_xref="RGD:1595217" exon 1..42 /gene="Cryga" /inference="alignment:Splign:2.1.0" CDS 34..558 /gene="Cryga" /note="CRY-gamma-A; gamma-A-crystallin; gamma-crystallin 1-1" /codon_start=1 /product="gamma-crystallin A" /protein_id="NP_001074405.1" /db_xref="GeneID:684028" /db_xref="RGD:1595217" /translation="
MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSIRVDSGCWMLYERPNYQGYQYFLRRGDYPDYQQWMGFSDSIRSCRSIPYTSSHRIRLYERDDYRGLVSELTEDCSCIHDRFRLNEIYSMHVLEGSWVLYEMPNYRGRQYLLRPGDYRRYHDWGAMDAKVGSLRRVMDLY"
misc_feature 40..279 /gene="Cryga" /note="Beta/gamma crystallins; Region: XTALbg; smart00247" /db_xref="CDD:214583" misc_feature 283..294 /gene="Cryga" /note="propagated from UniProtKB/Swiss-Prot (P10065.3); Region: Connecting peptide" misc_feature 298..543 /gene="Cryga" /note="Beta/Gamma crystallin; Region: Crystall; pfam00030" /db_xref="CDD:425430" exon 43..285 /gene="Cryga" /inference="alignment:Splign:2.1.0" exon 286..618 /gene="Cryga" /inference="alignment:Splign:2.1.0" ORIGIN
acactcaacactgaccatttgctgtcaacaacgatgggaaagatcaccttctacgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccatccgcgtggacagtggctgctggatgctctatgagcgacccaactaccagggctaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgttccattccctataccagctctcacaggataaggctgtacgagagagatgactaccggggccttgtgtctgagctcacggaagactgttcctgcatccacgaccgcttccgcctcaacgagatctactccatgcatgtgctagaaggcagctgggtcctctatgagatgcccaactaccgaggccgccagtacctgctcaggcctggagactacaggcgctaccacgactggggcgccatggatgccaaagtcggctctctgagacgggtcatggatttgtactaagccccattttgcttgttacaacacacacatgcaataaatatacaacttgtgttcctggca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]