LOCUS       NM_001080936             618 bp    mRNA    linear   ROD 17-JUL-2023
DEFINITION  Rattus norvegicus crystallin, gamma A (Cryga), mRNA.
ACCESSION   NM_001080936 XM_001066957 XM_001067011
VERSION     NM_001080936.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 618)
  AUTHORS   Graw J, Neuhauser-Klaus A, Klopp N, Selby PB, Loster J and Favor J.
  TITLE     Genetic and allelic heterogeneity of Cryg mutations in eight
            distinct forms of dominant cataract in the mouse
  JOURNAL   Invest Ophthalmol Vis Sci 45 (4), 1202-1213 (2004)
   PUBMED   15037589
REFERENCE   2  (bases 1 to 618)
  AUTHORS   Everett CA, Glenister PH, Taylor DM, Lyon MF, Kratochvilova-Loester
            J and Favor J.
  TITLE     Mapping of six dominant cataract genes in the mouse
  JOURNAL   Genomics 20 (3), 429-434 (1994)
   PUBMED   8034315
REFERENCE   3  (bases 1 to 618)
  AUTHORS   Voorter CE, De Haard-Hoekman WA, Hermans MM, Bloemendal H and De
            Jong WW.
  TITLE     Differential synthesis of crystallins in the developing rat eye
            lens
  JOURNAL   Exp Eye Res 50 (4), 429-437 (1990)
   PUBMED   2338125
REFERENCE   4  (bases 1 to 618)
  AUTHORS   den Dunnen JT, van Neck JW, Cremers FP, Lubsen NH and Schoenmakers
            JG.
  TITLE     Nucleotide sequence of the rat gamma-crystallin gene region and
            comparison with an orthologous human region
  JOURNAL   Gene 78 (2), 201-213 (1989)
   PUBMED   2777080
REFERENCE   5  (bases 1 to 618)
  AUTHORS   den Dunnen,J.T., Moormann,R.J., Lubsen,N.H. and Schoenmakers,J.G.
  TITLE     Concerted and divergent evolution within the rat gamma-crystallin
            gene family
  JOURNAL   J Mol Biol 189 (1), 37-46 (1986)
   PUBMED   3783678
REFERENCE   6  (bases 1 to 618)
  AUTHORS   Favor,J.
  TITLE     Characterization of dominant cataract mutations in mice:
            penetrance, fertility and homozygous viability of mutations
            recovered after 250 mg/kg ethylnitrosourea paternal treatment
  JOURNAL   Genet Res 44 (2), 183-197 (1984)
   PUBMED   6510713
REFERENCE   7  (bases 1 to 618)
  AUTHORS   Favor,J.
  TITLE     A comparison of the dominant cataract and recessive specific-locus
            mutation rates induced by treatment of male mice with
            ethylnitrosourea
  JOURNAL   Mutat Res 110 (2), 367-382 (1983)
   PUBMED   6877261
REFERENCE   8  (bases 1 to 618)
  AUTHORS   Ehling,U.H., Favor,J., Kratochvilova,J. and Neuhauser-Klaus,A.
  TITLE     Dominant cataract mutations and specific-locus mutations in mice
            induced by radiation or ethylnitrosourea
  JOURNAL   Mutat Res 92 (1-2), 181-192 (1982)
   PUBMED   7088001
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000214.1.
            
            On Nov 10, 2022 this sequence version replaced NM_001080936.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: mixed sample support SAMEA5760396, SAMN06680452
                              [ECO:0006172]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-42                JACYVU010000214.1  22479488-22479529   c
            43-285              JACYVU010000214.1  22479145-22479387   c
            286-618             JACYVU010000214.1  22477067-22477399   c
FEATURES             Location/Qualifiers
     source          1..618
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q32"
     gene            1..618
                     /gene="Cryga"
                     /note="crystallin, gamma A"
                     /db_xref="GeneID:684028"
                     /db_xref="RGD:1595217"
     exon            1..42
                     /gene="Cryga"
                     /inference="alignment:Splign:2.1.0"
     CDS             34..558
                     /gene="Cryga"
                     /note="CRY-gamma-A; gamma-A-crystallin; gamma-crystallin
                     1-1"
                     /codon_start=1
                     /product="gamma-crystallin A"
                     /protein_id="NP_001074405.1"
                     /db_xref="GeneID:684028"
                     /db_xref="RGD:1595217"
                     /translation="

MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSIRVDSGCWMLYERPNYQGYQYFLRRGDYPDYQQWMGFSDSIRSCRSIPYTSSHRIRLYERDDYRGLVSELTEDCSCIHDRFRLNEIYSMHVLEGSWVLYEMPNYRGRQYLLRPGDYRRYHDWGAMDAKVGSLRRVMDLY"

     misc_feature    40..279
                     /gene="Cryga"
                     /note="Beta/gamma crystallins; Region: XTALbg; smart00247"
                     /db_xref="CDD:214583"
     misc_feature    283..294
                     /gene="Cryga"
                     /note="propagated from UniProtKB/Swiss-Prot (P10065.3);
                     Region: Connecting peptide"
     misc_feature    298..543
                     /gene="Cryga"
                     /note="Beta/Gamma crystallin; Region: Crystall; pfam00030"
                     /db_xref="CDD:425430"
     exon            43..285
                     /gene="Cryga"
                     /inference="alignment:Splign:2.1.0"
     exon            286..618
                     /gene="Cryga"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

acactcaacactgaccatttgctgtcaacaacgatgggaaagatcaccttctacgaggaccgaggcttccagggccgctgctatgagtgcagcagcgactgccccaacctgcagacctacttcagccgctgcaactccatccgcgtggacagtggctgctggatgctctatgagcgacccaactaccagggctaccagtacttcctgcgacgcggggactaccctgactaccagcagtggatgggtttcagcgactccattcgctcctgccgttccattccctataccagctctcacaggataaggctgtacgagagagatgactaccggggccttgtgtctgagctcacggaagactgttcctgcatccacgaccgcttccgcctcaacgagatctactccatgcatgtgctagaaggcagctgggtcctctatgagatgcccaactaccgaggccgccagtacctgctcaggcctggagactacaggcgctaccacgactggggcgccatggatgccaaagtcggctctctgagacgggtcatggatttgtactaagccccattttgcttgttacaacacacacatgcaataaatatacaacttgtgttcctggca

//