2024-05-01 11:08:22, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001077649 898 bp mRNA linear ROD 11-NOV-2023 DEFINITION Rattus norvegicus chymotrypsin C (Ctrc), mRNA. ACCESSION NM_001077649 XM_001073208 XM_001076330 VERSION NM_001077649.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 898) AUTHORS Lacruz RS, Smith CE, Smith SM, Hu P, Bringas P Jr, Sahin-Toth M, Moradian-Oldak J and Paine ML. TITLE Chymotrypsin C (caldecrin) is associated with enamel development JOURNAL J Dent Res 90 (10), 1228-1233 (2011) PUBMED 21828354 REMARK GeneRIF: possibly involved in enamel development REFERENCE 2 (bases 1 to 898) AUTHORS Yoshino-Yasuda I, Kobayashi K, Akiyama M, Itoh H, Tomomura A and Saheki T. TITLE Caldecrin is a novel-type serine protease expressed in pancreas, but its homologue, elastase IV, is an artifact during cloning derived from caldecrin gene JOURNAL J Biochem 123 (3), 546-554 (1998) PUBMED 9538241 REFERENCE 3 (bases 1 to 898) AUTHORS Tomomura A, Akiyama M, Itoh H, Yoshino I, Tomomura M, Nishii Y, Noikura T and Saheki T. TITLE Molecular cloning and expression of human caldecrin JOURNAL FEBS Lett 386 (1), 26-28 (1996) PUBMED 8635596 REFERENCE 4 (bases 1 to 898) AUTHORS Tomomura A, Tomomura M, Fukushige T, Akiyama M, Kubota N, Kumaki K, Nishii Y, Noikura T and Saheki T. TITLE Molecular cloning and expression of serum calcium-decreasing factor (caldecrin) JOURNAL J Biol Chem 270 (51), 30315-30321 (1995) PUBMED 8530454 REFERENCE 5 (bases 1 to 898) AUTHORS Kang J, Wiegand U and Muller-Hill B. TITLE Identification of cDNAs encoding two novel rat pancreatic serine proteases JOURNAL Gene 110 (2), 181-187 (1992) PUBMED 1537555 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from S80379.1. On Aug 31, 2012 this sequence version replaced NM_001077649.1. ##Evidence-Data-START## Transcript exon combination :: S80379.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5756307 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-898 S80379.1 2-899 FEATURES Location/Qualifiers source 1..898 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="5" /map="5q36" gene 1..898 /gene="Ctrc" /note="chymotrypsin C" /db_xref="GeneID:362653" /db_xref="RGD:1308379" exon 1..52 /gene="Ctrc" /inference="alignment:Splign:2.1.0" misc_feature 7..9 /gene="Ctrc" /note="upstream in-frame stop codon" CDS 13..819 /gene="Ctrc" /EC_number="3.4.21.2" /note="preprocaldecrin; caldecrin; serum calcium-decreasing factor" /codon_start=1 /product="chymotrypsin-C precursor" /protein_id="NP_001071117.1" /db_xref="GeneID:362653" /db_xref="RGD:1308379" /translation="
MLGITVLAAILACASCCGNPAFPPNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHTCGGSLITTSHVLTAAHCINKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIAIIKLAEPVELSNTIQVACIPEEGSLLPQDYPCYVTGWGRLWTNGPIAEVLQQGLQPIVSHATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHKKPVVFTRVSAYNDWINEKIQL"
sig_peptide 13..60 /gene="Ctrc" /inference="COORDINATES: ab initio prediction:SignalP:4.0" misc_feature 85..87 /gene="Ctrc" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P55091.1); glycosylation site" mat_peptide 100..816 /gene="Ctrc" /product="Chymotrypsin-C. /id=PRO_0000027716" /note="propagated from UniProtKB/Swiss-Prot (P55091.1)" misc_feature 100..807 /gene="Ctrc" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 100..102 /gene="Ctrc" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(232..234,373..375,658..660) /gene="Ctrc" /note="active site" /db_xref="CDD:238113" misc_feature 280..282 /gene="Ctrc" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (P55091.1); glycosylation site" misc_feature order(640..642,718..720,724..726) /gene="Ctrc" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" exon 53..144 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 145..242 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 243..368 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 369..505 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 506..651 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 652..804 /gene="Ctrc" /inference="alignment:Splign:2.1.0" exon 805..880 /gene="Ctrc" /inference="alignment:Splign:2.1.0" ORIGIN
aacacctgaaccatgttgggaattacggtcctcgctgccatcctggcctgcgcctcttgctgcgggaaccccgccttcccacctaacctgtcaaccagagtggtaggaggagaggatgctgtccccaacagctggccttggcaggtctctctccagtacctcaaggacgacacatggaggcacacctgtgggggaagtctcatcaccaccagccacgtcctcactgccgcccactgcatcaacaaagacttcacttaccgtgtgggcctggggaagtataatctgacagtggaggatgaggaaggctccgtgtacgctgaggtggacaccatctacgtccatgagaagtggaaccgactcttcctgtggaacgacatcgctatcattaagttggctgagcctgtggaactgagcaacaccatccaggtggcctgcatcccagaggaaggttccctgctgcctcaggactatccctgctatgtcacgggctggggtcgcctctggaccaatggtcccatcgctgaagtgctccagcagggcctgcagcccatcgtgagccatgccacgtgctccaggttggactggtggttcatcaaggtccggaagacgatggtgtgcgctgggggtgatggcgtcatctctgcctgtaacggagattctggcggcccactgaactgccaagcagaagacggctcatggcaggtgcacggcatcgtgagcttcggttccagtagcggctgcaacgtacacaagaaaccggtagtcttcacccgagtgtctgcctacaatgactggatcaacgagaaaatacaactgtgaagaggccgttccagaagtctcgctgcccgtctcccaacagcaataaagcttcttccatgataaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]