GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-06 22:08:59, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001011889            1432 bp    mRNA    linear   ROD 20-MAR-2023
DEFINITION  Rattus norvegicus claudin 9 (Cldn9), mRNA.
ACCESSION   NM_001011889 XM_220203
VERSION     NM_001011889.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1432)
  AUTHORS   Harris HJ, Davis C, Mullins JG, Hu K, Goodall M, Farquhar MJ, Mee
            CJ, McCaffrey K, Young S, Drummer H, Balfe P and McKeating JA.
  TITLE     Claudin association with CD81 defines hepatitis C virus entry
  JOURNAL   J Biol Chem 285 (27), 21092-21102 (2010)
   PUBMED   20375010
REFERENCE   2  (bases 1 to 1432)
  AUTHORS   Krause G, Winkler L, Mueller SL, Haseloff RF, Piontek J and Blasig
            IE.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim Biophys Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   3  (bases 1 to 1432)
  AUTHORS   Nunes FD, Lopez LN, Lin HW, Davies C, Azevedo RB, Gow A and Kachar
            B.
  TITLE     Distinct subdomain organization and molecular composition of a
            tight junction with adherens junction features
  JOURNAL   J Cell Sci 119 (Pt 23), 4819-4827 (2006)
   PUBMED   17130295
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000219.1.
            
            On Mar 29, 2021 this sequence version replaced NM_001011889.1.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC087664.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1432              JACYVU010000219.1  747451-748882       c
FEATURES             Location/Qualifiers
     source          1..1432
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q12"
     gene            1..1432
                     /gene="Cldn9"
                     /note="claudin 9"
                     /db_xref="GeneID:287099"
                     /db_xref="RGD:1308999"
     exon            1..1432
                     /gene="Cldn9"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    361..363
                     /gene="Cldn9"
                     /note="upstream in-frame stop codon"
     CDS             364..1017
                     /gene="Cldn9"
                     /codon_start=1
                     /product="claudin-9"
                     /protein_id="NP_001011889.1"
                     /db_xref="GeneID:287099"
                     /db_xref="RGD:1308999"
                     /translation="
MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLTAGVLLLLSGILVLIPVCWTAHAIIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPSHFERPRGPRLGYSIPSRSGASGLDKRDYV"
     misc_feature    373..852
                     /gene="Cldn9"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      
tcacagttccctgttttgagacaagctgtataccggctgagagaagacttcaaccaagaaagaacgtgagcagccagcagagagggacgcggctgttcctagtccgtggcggatctggaggggctgtgatgggctgaaggcttccaagaagacacaagcaatacagctgagcgggacctaaggacttcttcgtattcagtgagtatcagatgtgtgagaggcccgcagatgtgaggtctggcctggcctgaaatcaacagcttcccctactgagcagtgagaaccacccgaactccaacacggtgctcccaaccctgttgagtgattcaggctgagagctgtgaagaccggaggagcagatagatggcttccactggccttgaactcctcggcatgaccctggctgtgctaggctggctaggaaccctggtgtcctgtgccctgccactgtggaaggtgaccgccttcattggcaacagcatcgttgtggcccaagtggtatgggaggggctgtggatgtcctgtgtggtccagagcactgggcagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggctgccagagccctctgtgtcgtggccctcctgctggctttgctgggcctgctggtggctatcacgggcgcccagtgcaccacatgtgtggaggacgaaggtgccaaggcacgtattgtgctcaccgcaggggtcctcctcctcctctcgggcatcctggtgctcatccccgtctgctggacagcccatgccatcatccaggacttttataacccactggttgctgaagctctcaagagagagctgggggcttccctctacctgggctgggccgccgctgcactgctcatgctcggaggagggctcctctgctgtacgtgtcccccgtcccacttcgagaggccccgcggccccaggctgggctactccatcccttcccgttcaggtgcttcgggacttgataagagggactatgtgtgagctgaggcttcttccagaagcttccaccttgcggccttatacctggcactgggctacatccttctatctcatcaaattcatgcgcctgggaagttcacttctttatttggccaggattcggctctagagggtgtcagctggtttggcttgagccaaccctctgcggtggcagcaaccttgagaaaactgcagatactgggtaccctgcccatcgccgtctcccaggatattgctgtgatttactttcctggactgatttactctggaacctgggcctcaggccccttgccttcaaaattagatgtggactgtgacctactagggtttcagctggtcaagtctagcccaagcagtccctgaattcaagttgctcagccccctgcccaacctgggaataaaagcacattgtaactga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]