2024-05-05 18:18:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001010964 1014 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus killer cell lectin like receptor B1A (Klrb1a), mRNA. ACCESSION NM_001010964 XM_342765 VERSION NM_001010964.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1014) AUTHORS Kovalska J, Cervinkova M, Chmelikova E, Planska D, Cizkova J and Horak V. TITLE Immunohistochemical Evidence of the Involvement of Natural Killer (CD161+) Cells in Spontaneous Regression of Lewis Rat Sarcoma JOURNAL In Vivo 33 (1), 47-52 (2019) PUBMED 30587601 REMARK GeneRIF: Based on the differences in number and distribution of the immune cell subpopulations, we believe that natural killer (CD161(+)) cells play a major role in the destruction of cancer cells during Spontaneous regression tumours in this Lewis rat model REFERENCE 2 (bases 1 to 1014) AUTHORS Aust JG, Gays F, Mickiewicz KM, Buchanan E and Brooks CG. TITLE The expression and function of the NKRP1 receptor family in C57BL/6 mice JOURNAL J Immunol 183 (1), 106-116 (2009) PUBMED 19535641 REFERENCE 3 (bases 1 to 1014) AUTHORS Kveberg L, Dai KZ, Westgaard IH, Daws MR, Fossum S, Naper C and Vaage JT. TITLE Two major groups of rat NKR-P1 receptors can be distinguished based on chromosomal localization, phylogenetic analysis and Clr ligand binding JOURNAL Eur J Immunol 39 (2), 541-551 (2009) PUBMED 19130483 REFERENCE 4 (bases 1 to 1014) AUTHORS Voigt S, Mesci A, Ettinger J, Fine JH, Chen P, Chou W and Carlyle JR. TITLE Cytomegalovirus evasion of innate immunity by subversion of the NKR-P1B:Clr-b missing-self axis JOURNAL Immunity 26 (5), 617-627 (2007) PUBMED 17462921 REFERENCE 5 (bases 1 to 1014) AUTHORS Li J, Rabinovich BA, Hurren R, Shannon J and Miller RG. TITLE Expression cloning and function of the rat NK activating and inhibitory receptors NKR-P1A and -P1B JOURNAL Int Immunol 15 (3), 411-416 (2003) PUBMED 12618485 REFERENCE 6 (bases 1 to 1014) AUTHORS Campbell KS and Giorda R. TITLE The cytoplasmic domain of rat NKR-P1 receptor interacts with the N-terminal domain of p56(lck) via cysteine residues JOURNAL Eur J Immunol 27 (1), 72-77 (1997) PUBMED 9022000 REMARK Erratum:[Eur J Immunol. 1997 Mar;27(3):802. PMID: 9079826] REFERENCE 7 (bases 1 to 1014) AUTHORS Giorda R, Weisberg EP, Ip TK and Trucco M. TITLE Genomic structure and strain-specific expression of the natural killer cell receptor NKR-P1 JOURNAL J Immunol 149 (6), 1957-1963 (1992) PUBMED 1517565 REFERENCE 8 (bases 1 to 1014) AUTHORS Giorda R, Rudert WA, Vavassori C, Chambers WH, Hiserodt JC and Trucco M. TITLE NKR-P1, a signal transduction molecule on natural killer cells JOURNAL Science 249 (4974), 1298-1300 (1990) PUBMED 2399464 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from JACYVU010000150.1. On Nov 27, 2020 this sequence version replaced NM_001010964.1. ##Evidence-Data-START## Transcript exon combination :: M62891.1, FJ416340.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN16676810 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-104 JACYVU010000150.1 4702828-4702931 c 105-203 JACYVU010000150.1 4700622-4700720 c 204-275 JACYVU010000150.1 4699422-4699493 c 276-430 JACYVU010000150.1 4693476-4693630 c 431-546 JACYVU010000150.1 4693018-4693133 c 547-1014 JACYVU010000150.1 4689458-4689925 c FEATURES Location/Qualifiers source 1..1014 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="4" /map="4q42" gene 1..1014 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="killer cell lectin like receptor B1A" /db_xref="GeneID:362443" /db_xref="RGD:1586149" exon 1..104 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" CDS 17..688 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="NKR-P1 3.2.3; antigen 3.2.3; CD161 antigen-like family member A; killer cell lectin-like receptor subfamily B, member 1A; natural killer cell surface protein P1-3.2.3" /codon_start=1 /product="killer cell lectin-like receptor subfamily B member 1A" /protein_id="NP_001010964.1" /db_xref="GeneID:362443" /db_xref="RGD:1586149" /translation="
MDTARVYLSLKPSKTAAGAQCVSPPSLPPDACRCPRSHRLALKLSCAGLILLVLALVGMSILVRVLVQKPSVEPCRVLIQENLSKTGSPAKLKCPKDWLSHRDKCFHVSQTSITWKESLADCGGKGATLLLVQDQEELRFLRNLTKRISSSFWIGLSYTLSDENWKWINGSTLNSDVLSITGDTEKDSCASVSQDKVLSESCDSDNIWVCQKELKCECMCNDS"
misc_feature 110..121 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="propagated from UniProtKB/Swiss-Prot (P27471.1); Region: LCK-binding motif" misc_feature 146..205 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="propagated from UniProtKB/Swiss-Prot (P27471.1); transmembrane region" misc_feature 296..652 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs); Region: CLECT_NK_receptors_like; cd03593" /db_xref="CDD:153063" misc_feature order(467..469,551..553,602..604,608..613) /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153063" exon 105..203 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" exon 204..275 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" exon 276..430 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" exon 431..546 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" exon 547..1014 /gene="Klrb1a" /gene_synonym="NKR-P1A; Nkrp1a" /inference="alignment:Splign:2.1.0" ORIGIN
gcctctcccaagtacaatggacacagcacgtgtctacctcagtttaaagccatccaagactgccgcgggggctcagtgtgtatcacctccatctcttcccccagatgcctgtcggtgcccacgttcacacaggttggctttgaagctcagctgcgctgggctgatccttcttgtcttggccctggttgggatgagtattttagtgcgagtcttagttcaaaaaccatcagtggagccatgccgagtgcttattcaagagaacctgagtaaaacaggtagtccagctaagttaaagtgcccaaaagactggctttcacaccgagataaatgctttcatgtttctcaaacttccatcacttggaaggaaagtctagctgactgtggtggaaaaggagccacgttgctgctcgttcaagaccaagaagaactgagattcctacggaacttgacaaagagaataagcagctcattctggattggattaagttacacattgtcagacgagaactggaagtggataaacggctcgactttaaattctgatgtattaagcatcactggtgacactgaaaaggacagctgtgcctccgtctcacaggacaaagtgctttctgagagctgtgattcagacaatatatgggtctgccaaaaggaactaaaatgtgaatgcatgtgtaatgactcctgactgcgaatcacacctggattactttaccatccacaccagatctctgcctgacctgtctgtctctgctgcctgcctcccagtgcagcactggcacaaagcatggactctgaaagcactgagtcttatagagtcttcgttgtgtagatgtaaacgtacgcagacacagatgtgccatcctgtgagggagttctgtggaaagaagaccaggcagctgagggtcactggattctaatcctggagtctgtgtgaccttcgttggtctctgtgtctgaggtcatctgcaaaatagccatttgcaaaaatcattaaaatgctcctctgcaggg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]