LOCUS       NM_001009920            1508 bp    mRNA    linear   ROD 23-MAR-2023
DEFINITION  Rattus norvegicus glutathione S-transferase alpha 3 (Gsta3),
            transcript variant 1, mRNA.
ACCESSION   NM_001009920 XM_579318
VERSION     NM_001009920.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1508)
  AUTHORS   Xiao Y, Zhang Z, Fu Y, Shan H, Cui S and Wu J.
  TITLE     GSTA3 regulates TGF-beta1-induced renal interstitial fibrosis in
            NRK-52E cells as a component of the PI3K-Keap1/Nrf2 pathway
  JOURNAL   J Int Med Res 47 (11), 5787-5801 (2019)
   PUBMED   31617428
  REMARK    GeneRIF: The PI3K-KEAP1/Nrf2-GSTA3 signaling pathway is a possible
            mechanism of resisting external stimulation of renal fibrosis
            factors.
REFERENCE   2  (bases 1 to 1508)
  AUTHORS   Chen H, Gan Q, Yang C, Peng X, Qin J, Qiu S, Jiang Y, Tu S, He Y,
            Li S, Yang H, Tao L and Peng Y.
  TITLE     A novel role of glutathione S-transferase A3 in inhibiting hepatic
            stellate cell activation and rat hepatic fibrosis
  JOURNAL   J Transl Med 17 (1), 280 (2019)
   PUBMED   31443720
  REMARK    GeneRIF: GSTA3 inhibited hepatic stellate cell activation and liver
            fibrosis
            Erratum:[J Transl Med. 2020 Apr 30;18(1):182. PMID: 32354374]
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1508)
  AUTHORS   Xiao Y, Liu J, Peng Y, Xiong X, Huang L, Yang H, Zhang J and Tao L.
  TITLE     GSTA3 Attenuates Renal Interstitial Fibrosis by Inhibiting
            TGF-Beta-Induced Tubular Epithelial-Mesenchymal Transition and
            Fibronectin Expression
  JOURNAL   PLoS One 11 (9), e0160855 (2016)
   PUBMED   27602565
  REMARK    GeneRIF: Protein and mRNA expression of GSTA3 in UUO rats and
            NRK-52E cells were determined by Western blot and RT-PCR. siRNA and
            overexpression plasmid were transfected specifically to assess the
            role of GSTA3 in renal interstitial fibrosis
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1508)
  AUTHORS   Ilic Z, Crawford D, Vakharia D, Egner PA and Sell S.
  TITLE     Glutathione-S-transferase A3 knockout mice are sensitive to acute
            cytotoxic and genotoxic effects of aflatoxin B1
  JOURNAL   Toxicol Appl Pharmacol 242 (3), 241-246 (2010)
   PUBMED   19850059
  REMARK    Erratum:[Toxicol Appl Pharmacol. 2010 Jun 1;245(2):280. PMID:
            20852735]
REFERENCE   5  (bases 1 to 1508)
  AUTHORS   Caruana G, Cullen-McEwen L, Nelson AL, Kostoulias X, Woods K,
            Gardiner B, Davis MJ, Taylor DF, Teasdale RD, Grimmond SM, Little
            MH and Bertram JF.
  TITLE     Spatial gene expression in the T-stage mouse metanephros
  JOURNAL   Gene Expr Patterns 6 (8), 807-825 (2006)
   PUBMED   16545622
REFERENCE   6  (bases 1 to 1508)
  AUTHORS   Pulford DJ and Hayes JD.
  TITLE     Characterization of the rat glutathione S-transferase Yc2 subunit
            gene, GSTA5: identification of a putative antioxidant-responsive
            element in the 5'-flanking region of rat GSTA5 that may mediate
            chemoprotection against aflatoxin B1
  JOURNAL   Biochem J 318 (Pt 1) (Pt 1), 75-84 (1996)
   PUBMED   8761455
REFERENCE   7  (bases 1 to 1508)
  AUTHORS   Hayes JD, Nguyen T, Judah DJ, Petersson DG and Neal GE.
  TITLE     Cloning of cDNAs from fetal rat liver encoding glutathione
            S-transferase Yc polypeptides. The Yc2 subunit is expressed in
            adult rat liver resistant to the hepatocarcinogen aflatoxin B1
  JOURNAL   J Biol Chem 269 (32), 20707-20717 (1994)
   PUBMED   8051171
REFERENCE   8  (bases 1 to 1508)
  AUTHORS   Klinga-Levan K, Andersson A, Hanson C, Ridderstrom M, Stenberg G,
            Mannervik B, Vajdy M, Szpirer J, Szpirer C and Levan G.
  TITLE     Mapping of glutathione transferase (GST) genes in the rat
  JOURNAL   Hereditas 119 (3), 285-296 (1993)
   PUBMED   8144363
REFERENCE   9  (bases 1 to 1508)
  AUTHORS   Hayes JD, Judah DJ, McLellan LI, Kerr LA, Peacock SD and Neal GE.
  TITLE     Ethoxyquin-induced resistance to aflatoxin B1 in the rat is
            associated with the expression of a novel alpha-class glutathione
            S-transferase subunit, Yc2, which possesses high catalytic activity
            for aflatoxin B1-8,9-epoxide
  JOURNAL   Biochem J 279 (Pt 2) (Pt 2), 385-398 (1991)
   PUBMED   1953636
REFERENCE   10 (bases 1 to 1508)
  AUTHORS   Pickett,C.B., Telakowski-Hopkins,C.A., Ding,G.J., Argenbright,L.
            and Lu,A.Y.
  TITLE     Rat liver glutathione S-transferases. Complete nucleotide sequence
            of a glutathione S-transferase mRNA and the regulation of the Ya,
            Yb, and Yc mRNAs by 3-methylcholanthrene and phenobarbital
  JOURNAL   J Biol Chem 259 (8), 5182-5188 (1984)
   PUBMED   6325423
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JACYVU010000213.1.
            
            On Nov 23, 2013 this sequence version replaced NM_001009920.1.
            
            Transcript Variant: This variant (1) represents the longest
            transcript. Variants 1 and 2 encode the same protein (isoform 1).
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the Celera
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X78847.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760389
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-315               JACYVU010000213.1  13021168-13021482
            316-367             JACYVU010000213.1  13025464-13025515
            368-500             JACYVU010000213.1  13027684-13027816
            501-642             JACYVU010000213.1  13028879-13029020
            643-774             JACYVU010000213.1  13031500-13031631
            775-1508            JACYVU010000213.1  13034044-13034777
FEATURES             Location/Qualifiers
     source          1..1508
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="9"
                     /map="9q13"
     gene            1..1508
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="glutathione S-transferase alpha 3"
                     /db_xref="GeneID:494500"
                     /db_xref="RGD:1591980"
     exon            1..315
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    205..207
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="upstream in-frame stop codon"
     CDS             229..894
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /EC_number="2.5.1.18"
                     /note="isoform 1 is encoded by transcript variant 1;
                     glutathione S-transferase alpha-5; GST Yc2; GST A5-5;
                     glutathione S-transferase Yc2 subunit; glutathione
                     S-transferase A3"
                     /codon_start=1
                     /product="glutathione S-transferase alpha-5 isoform 1"
                     /protein_id="NP_001009920.1"
                     /db_xref="GeneID:494500"
                     /db_xref="RGD:1591980"
                     /translation="

MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEENFLKTRDDLARLRSDGSLMFEQVPMVEIDGMKLVQTKAILNYIATKYNLYGKDMKERALIDMYAEGVADLELMVLYYPYMPPGEKEASLAKIKDKARNRYFPAYEKVLKSHGQDYLVGNKLSRADVSLVELLYHVEEMDPGIVDNFPLLKALRTRVSNLPTVKKFLQPGSQRKPFDDEKCVESAKKIFS"

     misc_feature    238..474
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="GST_N family, Class Alpha subfamily; GSTs are
                     cytosolic dimeric proteins involved in cellular
                     detoxification by catalyzing the conjugation of
                     glutathione (GSH) with a wide range of endogenous and
                     xenobiotic alkylating agents, including carcinogens;
                     Region: GST_N_Alpha; cd03077"
                     /db_xref="CDD:239375"
     misc_feature    order(259..261,265..267,271..273,277..282,289..291,
                     298..303,322..324,334..336,433..435,442..447)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="C-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239375"
     misc_feature    order(361..363,388..393,427..432)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="GSH binding site (G-site) [chemical binding]; other
                     site"
                     /db_xref="CDD:239375"
     misc_feature    order(382..387,409..411,424..429,433..438,445..450,
                     460..462)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239375"
     misc_feature    484..888
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="C-terminal, alpha helical domain of Class Alpha
                     Glutathione S-transferases; Region: GST_C_Alpha; cd03208"
                     /db_xref="CDD:198317"
     misc_feature    order(484..489,493..495,505..513,517..522,529..531,
                     619..621)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:198317"
     misc_feature    order(517..519,538..540,547..549,556..561,619..624,
                     631..633,682..693,700..702,709..714,721..726,733..735,
                     805..810,814..831)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="N-terminal domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198317"
     misc_feature    order(529..531,547..549,559..561,619..621,850..852,
                     874..876,886..888)
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /note="substrate binding pocket (H-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:198317"
     exon            316..367
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
     exon            368..500
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
     exon            501..642
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
     exon            643..774
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
     exon            775..1508
                     /gene="Gsta3"
                     /gene_synonym="Gsta5; Yc2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

aagtcacatattaaccgatggatacactaaactggtttggtgcaacctgagggtggctcctgataggtaccaatttggaccatggaacagagtccaggaatgtttccgaccctgccctaaagaaggcagacacttctttagcagccgttgtccagaccccctcgtaggacagactgttagaacaggctgtgcttcatctctgtttagagaactcaagcaattgctgccatgccggggaagccagtccttcactacttcgatggcagggggagaatggagcccatccggtggctcctggctgcagctggagtagagtttgaagaaaattttctgaaaactcgggatgacctggccaggttaagaagtgatgggagtttgatgtttgaacaagtgcccatggtggagattgacgggatgaagctggtgcagaccaaagccattctcaactacattgccaccaaatacaacctctatgggaaggacatgaaggagagagccctcatcgacatgtatgcagaaggtgtggccgatctggagttgatggttctctattacccctacatgccccctggggagaaagaggcgagtcttgccaagatcaaggacaaagcaaggaaccgttacttccctgcctatgagaaggtgttgaagagccacggacaagattatctcgttggcaacaagctgagcagggctgatgtttccctggttgaacttctctaccatgtggaagagatggacccaggcattgtggacaacttccctctgctaaaggccctgagaaccagagtcagcaacctccccacagtgaagaaatttcttcagcctggcagccagaggaagccttttgatgatgagaaatgtgtagaatcagcgaagaagatcttcagttaattcagtcagctatggatacactgtacccacaaagccagcctcagaaagctctgcaacaatgaagtattttgactaaatgttgaccgtacttattgggagggtaacatgttttctaaggcttctgtgttaattcatatagacatgactcatgaggaattgctgggatgccatctagttgagttaaaacctcaatctcgatcacttcctcggatattttcttaatgttcaataaaacaaaacaagcttcttagacgctggagtatccaaacattgtcatgaaatagctgtcatatccttgtcaaacagcgtcacgtagaaaccctcgtgtcaaactctcttacgcaaaagtaatctttccttatggagagtgtcctttctagtgaaatacacgcagacgtgtgtgcactcaaactgtgaagaactgttttccttcaacttctgaatggttttcttattcaattactccgtcagtacatttatgtccaatatagagcagtcattcttcctgggagctgcatgaatgatgaatgtggcagggataatcatttacccagccccagagtctgtggatttctgtaataaatgtaataataaaagcttaggtattcctaata

//