GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-28 02:14:10, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_011243193             984 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus sulfotransferase family 3A, member 1
            (Sult3a1), transcript variant X2, mRNA.
ACCESSION   XM_011243193
VERSION     XM_011243193.1
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000076.7) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..984
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="10"
     gene            1..984
                     /gene="Sult3a1"
                     /gene_synonym="ST3A1; Sult-x2; Sultx2"
                     /note="sulfotransferase family 3A, member 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins, and 100% coverage of the annotated genomic
                     feature by RNAseq alignments, including 1 sample with
                     support for all annotated introns"
                     /db_xref="GeneID:57430"
                     /db_xref="MGI:MGI:1931469"
     CDS             64..945
                     /gene="Sult3a1"
                     /gene_synonym="ST3A1; Sult-x2; Sultx2"
                     /codon_start=1
                     /product="amine sulfotransferase isoform X1"
                     /protein_id="XP_011241495.1"
                     /db_xref="GeneID:57430"
                     /db_xref="MGI:MGI:1931469"
                     /translation="
MDNKDEYLLNFKGYNFQKTLVKMEVVENIENYEIRDDDIFIVTYPKSGTIWTQQILSLIYFEGHRNRTENIETIDRAPFFEYNIHKLDYAKMPSPRIFSSHIPYYLVPKGLKDKKAKILYIYRNPKDVLISYFHFSNLMLIFQNPDTVESFMQTFLDGDVVGSLWFDHIRGWYEHRHDFNIMFMSFEDMKKDLRSSVLKICSFLEKELSEEDVDAVVRQATFQKMKADPRANYEHIIKDELGTRNEMGSFLRKGVVGDWKHYLTVDQSERFDKIFHRNMKNIPLKFIWDINEE"
     misc_feature    169..903
                     /gene="Sult3a1"
                     /gene_synonym="ST3A1; Sult-x2; Sultx2"
                     /note="Sulfotransferase domain; Region: Sulfotransfer_1;
                     pfam00685"
                     /db_xref="CDD:425820"
ORIGIN      
agcagacttggtactgtttctgcaactgatctgcaactgcaagtagtcaaatggtaacaaattatggacaataaagatgaatatttgcttaacttcaaaggctataattttcagaaaactttagttaaaatggaagtagtggaaaatatagaaaattatgaaattcgagatgatgacatcttcattgtcacatatccaaagtctggtaccatctggacccagcagatcctttccttgatttattttgagggtcatcggaacagaactgaaaacatcgaaacaatagatagagcaccattttttgagtacaatattcacaaattagactatgccaaaatgccatcacctcgcatcttcagttcccacattccatattacttagtaccaaaaggtctcaaggacaaaaaagccaaaattctttatatctacagaaatcctaaagatgttttgatctcctattttcatttctcaaatttgatgcttatatttcaaaatccagacactgtagaaagttttatgcaaacatttctagatggagatgtggtaggaagcctttggtttgaccacataagaggctggtatgaacacagacatgatttcaatattatgttcatgagctttgaagacatgaagaaggacctcagaagctcagtgcttaaaatctgcagttttctggagaaagaactgagtgaagaagatgtggatgctgttgtgagacaagctacctttcagaaaatgaaagctgacccaagagcaaactatgaacacattataaaagatgaactcggaacaagaaatgagatgggaagtttccttcgcaaaggtgttgttggagactggaaacattatttgactgtggatcagagtgaaagatttgacaagatatttcacagaaacatgaaaaacatccccttaaaattcatctgggacataaatgaggagtagaatattaatcaccacgtgaataaaccatatgaaaatgta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]