LOCUS       XM_006512694             930 bp    mRNA    linear   ROD 07-FEB-2024
DEFINITION  PREDICTED: Mus musculus sulfotransferase family 3A, member 2
            (Sult3a2), transcript variant X1, mRNA.
ACCESSION   XM_006512694
VERSION     XM_006512694.1
DBLINK      BioProject: PRJNA169
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000076.7) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_000001635.27-RS_2024_02
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 02/01/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..930
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6J"
                     /db_xref="taxon:10090"
                     /chromosome="10"
     gene            1..930
                     /gene="Sult3a2"
                     /gene_synonym="EG215895; Gm4794"
                     /note="sulfotransferase family 3A, member 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 mRNA, 4 Proteins, and 65% coverage of the annotated
                     genomic feature by RNAseq alignments"
                     /db_xref="GeneID:215895"
                     /db_xref="MGI:MGI:3645972"
     CDS             49..930
                     /gene="Sult3a2"
                     /gene_synonym="EG215895; Gm4794"
                     /codon_start=1
                     /product="uncharacterized protein LOC215895 isoform X1"
                     /protein_id="XP_006512757.1"
                     /db_xref="GeneID:215895"
                     /db_xref="MGI:MGI:3645972"
                     /translation="

MDNKDEDIFKFKGYNFLRALVSMDIVKNMEDYEIRDDDIFIVTYPKSGTTWTQQILCLICFESHRNGTENIATIDRIPSFEYNIHKLDYAKMPSPRIFTSHIPYYLVPKGLKDKKAKIIYVYRNPKDVLISFFHFSNLMVVLKASDTLENFMQRFLNGNLVGSLWFDHIRGWYEHRHDFNIMFMSFEDMKKDLRSSVLKICSFLEKELSEEDMDAVVRQATFEKMKADPRANNEHIIKDELGTRNNTGAFLRKGIVGDWKHYLTVDQSERFDKIFHMNMKNIPLKFIWNINEK"

     misc_feature    154..888
                     /gene="Sult3a2"
                     /gene_synonym="EG215895; Gm4794"
                     /note="Sulfotransferase domain; Region: Sulfotransfer_1;
                     pfam00685"
                     /db_xref="CDD:425820"
ORIGIN      

gtttccacaacggagctgcaactgcatctagtcaaatggtgactaattatggacaataaagatgaagatatttttaaattcaaaggctataattttctcagagcgttagttagtatggatatagtgaaaaatatggaagattatgaaattcgggatgatgacatctttatagtcacatacccaaagtctggtaccacctggactcaacagatcctctgcttaatttgttttgagagtcaccggaatggaactgaaaacatcgcaacaatagatagaataccatcctttgagtacaatattcacaaattagactatgccaaaatgccatcccctcgaatcttcacttcccacattccatattacttagtaccaaaaggtctcaaggacaaaaaagccaaaattatttatgtctacagaaatcctaaagatgttttgatctccttttttcatttctcaaatttgatggttgtactcaaagcttcagatactctggaaaattttatgcaaagatttctaaatggaaacttggtaggaagcctttggtttgaccacataagaggctggtatgaacacagacatgatttcaatataatgttcatgagctttgaagacatgaagaaggacctcagaagctcagtgcttaaaatctgcagttttctggagaaagaactgagtgaagaagatatggatgctgttgtgagacaagctacctttgagaaaatgaaagctgacccacgagcaaacaatgaacacattataaaagatgaactcggaacaagaaataatacgggagctttccttcgcaaaggtatcgttggagactggaaacattatttgactgtggatcaaagtgaaagatttgacaagatatttcatatgaacatgaaaaacatccccttaaaattcatttggaatataaatgagaagtag

//