GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-13 15:49:21, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_183248               1290 bp    mRNA    linear   ROD 29-OCT-2024
DEFINITION  Mus musculus NK6 homeobox 2 (Nkx6-2), transcript variant 1, mRNA.
ACCESSION   NM_183248
VERSION     NM_183248.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1290)
  AUTHORS   Ohyama,K., Shinohara,H.M., Takayama,N., Ogawa,R., Omura,S.,
            Hayashida,M. and Takahashi,T.
  TITLE     Differentiation stage-specific expression of transcriptional
            regulators for epithelial mesenchymal transition in dentate granule
            progenitors
  JOURNAL   Front Neurosci 18, 1425849 (2024)
   PUBMED   39268037
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1290)
  AUTHORS   Zhang,Y., Song,Z., Wu,R., Kong,X., Zhang,H., Li,S., Gong,X.,
            Gong,S., Cheng,J., Yuan,F., Wu,H., Wang,S. and Yuan,Z.
  TITLE     PRRC2B modulates oligodendrocyte progenitor cell development and
            myelination by stabilizing Sox2 mRNA
  JOURNAL   Cell Rep 43 (3), 113930 (2024)
   PUBMED   38507412
REFERENCE   3  (bases 1 to 1290)
  AUTHORS   Bechelli,L., Tomasella,E., Cardoso,S.L., Belmonte,M. and
            Gelman,D.M.
  TITLE     Selective dopamine D2 receptor deletion from Nkx6.2 expressing
            cells causes impaired cognitive, motivation and anxiety phenotypes
            in mice
  JOURNAL   Sci Rep 13 (1), 19473 (2023)
   PUBMED   37945756
  REMARK    GeneRIF: Selective dopamine D2 receptor deletion from Nkx6.2
            expressing cells causes impaired cognitive, motivation and anxiety
            phenotypes in mice.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1290)
  AUTHORS   Cheffer,A., Garcia-Miralles,M., Maier,E., Akol,I., Franz,H.,
            Srinivasan,V.S.V. and Vogel,T.
  TITLE     DOT1L deletion impairs the development of cortical
            parvalbumin-expressing interneurons
  JOURNAL   Cereb Cortex 33 (19), 10272-10285 (2023)
   PUBMED   37566909
REFERENCE   5  (bases 1 to 1290)
  AUTHORS   Sans,M., Makino,Y., Min,J., Rajapakshe,K.I., Yip-Schneider,M.,
            Schmidt,C.M., Hurd,M.W., Burks,J.K., Gomez,J.A., Thege,F.I.,
            Fahrmann,J.F., Wolff,R.A., Kim,M.P., Guerrero,P.A. and Maitra,A.
  TITLE     Spatial Transcriptomics of Intraductal Papillary Mucinous Neoplasms
            of the Pancreas Identifies NKX6-2 as a Driver of Gastric
            Differentiation and Indolent Biological Potential
  JOURNAL   Cancer Discov 13 (8), 1844-1861 (2023)
   PUBMED   37285225
  REMARK    GeneRIF: Spatial Transcriptomics of Intraductal Papillary Mucinous
            Neoplasms of the Pancreas Identifies NKX6-2 as a Driver of Gastric
            Differentiation and Indolent Biological Potential.
REFERENCE   6  (bases 1 to 1290)
  AUTHORS   Awatramani,R., Beesley,J., Yang,H., Jiang,H., Cambi,F.,
            Grinspan,J., Garbern,J. and Kamholz,J.
  TITLE     Gtx, an oligodendrocyte-specific homeodomain protein, has repressor
            activity
  JOURNAL   J Neurosci Res 61 (4), 376-387 (2000)
   PUBMED   10931524
REFERENCE   7  (bases 1 to 1290)
  AUTHORS   Qiu,M., Shimamura,K., Sussel,L., Chen,S. and Rubenstein,J.L.
  TITLE     Control of anteroposterior and dorsoventral domains of Nkx-6.1 gene
            expression relative to other Nkx genes during vertebrate CNS
            development
  JOURNAL   Mech Dev 72 (1-2), 77-88 (1998)
   PUBMED   9533954
REFERENCE   8  (bases 1 to 1290)
  AUTHORS   Awatramani,R., Scherer,S., Grinspan,J., Collarini,E., Skoff,R.,
            O'Hagan,D., Garbern,J. and Kamholz,J.
  TITLE     Evidence that the homeodomain protein Gtx is involved in the
            regulation of oligodendrocyte myelination
  JOURNAL   J Neurosci 17 (17), 6657-6668 (1997)
   PUBMED   9254678
REFERENCE   9  (bases 1 to 1290)
  AUTHORS   Lih,C.J., Cohen,S.N., Wang,C. and Lin-Chao,S.
  TITLE     The platelet-derived growth factor alpha-receptor is encoded by a
            growth-arrest-specific (gas) gene
  JOURNAL   Proc Natl Acad Sci U S A 93 (10), 4617-4622 (1996)
   PUBMED   8643452
REFERENCE   10 (bases 1 to 1290)
  AUTHORS   Komuro,I., Schalling,M., Jahn,L., Bodmer,R., Jenkins,N.A.,
            Copeland,N.G. and Izumo,S.
  TITLE     Gtx: a novel murine homeobox-containing gene, expressed
            specifically in glial cells of the brain and germ cells of testis,
            has a transcriptional repressor activity in vitro for a
            serum-inducible promoter
  JOURNAL   EMBO J 12 (4), 1387-1401 (1993)
   PUBMED   8096811
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC112670.11.
            
            On Sep 30, 2022 this sequence version replaced NM_183248.3.
            
            Transcript Variant: This variant (1) encodes the functional
            protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR7652917.105522.1, L08074.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849376, SAMN00849377
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-669               AC112670.11        124850-125518       c
            670-842             AC112670.11        124597-124769       c
            843-1290            AC112670.11        123957-124404       c
FEATURES             Location/Qualifiers
     source          1..1290
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 84.57 cM"
     gene            1..1290
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="NK6 homeobox 2"
                     /db_xref="GeneID:14912"
                     /db_xref="MGI:MGI:1352738"
     exon            1..669
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    135..137
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="upstream in-frame stop codon"
     CDS             264..1097
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="Drosophila NK transcription factor related, gene
                     family 6, locus 2; glial and testis specific homeobox; NK6
                     transcription factor related, locus 2"
                     /codon_start=1
                     /product="homeobox protein Nkx-6.2"
                     /protein_id="NP_899071.2"
                     /db_xref="CCDS:CCDS40170.1"
                     /db_xref="GeneID:14912"
                     /db_xref="MGI:MGI:1352738"
                     /translation="
MDANRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKTPALGSLGAQLPLGTPHGISDILGRPVGAAGGGLLGSLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPGVVQGSPWRDPRLAGSAQAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDDEYNRPLDPNSDDEKITRLLKKHKPSNLALVSPCGGSAGDAL"
     misc_feature    702..878
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            670..842
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /inference="alignment:Splign:2.1.0"
     exon            843..1290
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1271..1276
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="hexamer: AATAAA"
     polyA_site      1290
                     /gene="Nkx6-2"
                     /gene_synonym="Gtx; Nkx6.2"
                     /note="major polyA site"
ORIGIN      
gctccgacctgccccggagccgccactgccgctcccgccgcccttagtatccctgccttctctctgaccgccgcccattcagcgcaacagccgtcggtcctctcgctttcccgtaggggccgtcggcgttcgtttgaaacgcggtccacccgtcccagcgtagccggcgctcttcggcgccgcgcgcaaacttcccgagccggcgggtgcgggcggtggcagcggggcccggatgggcgcccgggtcggaggcggcggcgcccatggacgctaaccgcccgggtgcgtttgtgctgagcagcgcgcctttagccgcgctgcacaacatggctgagatgaagacgtcgctgttcccctacgcgctgcagggcccggcgggcttcaagacacccgccctaggcagccttggcgcgcagttgcctctaggcactccgcacggcatcagcgacatcctgggacggccggtgggcgcagcgggtggcggcctcctaggaagtctgccccgtctcaacgggctcgcctcgtctgcaggtgtctacttcgggcccgcagccgccgtggctcggggctaccccaagccgctggcggaactgcctgggcgcccgcccatcttctggcctggggtggtgcagggctctccctggagggacccgcgactggccggctccgcccaagccggcggggtcctggataaggatggcaagaagaaacactcgcggccgactttctccggccagcagatcttcgcgctggagaagactttcgagcagaccaagtatttggcaggcccagagcgcgcgcggcttgcctactctctgggcatgaccgagagccaagtgaaggtgtggttccagaatcggcggaccaagtggcgcaagcggcacgcggcagagatggcgtcggctaaaaagaagcaagactcggatgccgagaagctgaaggtgggtggctcagacgcggaggacgatgacgaatacaaccggcccctggaccccaactccgatgacgagaagatcacgcggcttctcaaaaagcacaaaccctcgaacttggcgctcgttagcccgtgtggtggcagcgcgggggacgccttgtgaggacgcggccaggccggagaacccgagaaccgggactcgcggcatgccccgacgccagccgcccagccgcagtgtgtatatatatttttacagaataagttataaagcggacgttggcgcggccttggcgtgatggcggagtacggggtttgggccgatcactttgtataatcaataaattatttaacacgtc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]