2024-05-04 04:21:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_178245 875 bp mRNA linear ROD 06-AUG-2023 DEFINITION Mus musculus brain specific homeobox (Bsx), mRNA. ACCESSION NM_178245 VERSION NM_178245.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 875) AUTHORS Magno L, Asgarian Z, Apanaviciute M, Milner Y, Bengoa-Vergniory N, Rubin AN and Kessaris N. TITLE Fate mapping reveals mixed embryonic origin and unique developmental codes of mouse forebrain septal neurons JOURNAL Commun Biol 5 (1), 1137 (2022) PUBMED 36302841 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 875) AUTHORS Newman EA, Wu D, Taketo MM, Zhang J and Blackshaw S. TITLE Canonical Wnt signaling regulates patterning, differentiation and nucleogenesis in mouse hypothalamus and prethalamus JOURNAL Dev Biol 442 (2), 236-248 (2018) PUBMED 30063881 REFERENCE 3 (bases 1 to 875) AUTHORS Lee B, Kim J, An T, Kim S, Patel EM, Raber J, Lee SK, Lee S and Lee JW. TITLE Dlx1/2 and Otp coordinate the production of hypothalamic GHRH- and AgRP-neurons JOURNAL Nat Commun 9 (1), 2026 (2018) PUBMED 29795232 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 875) AUTHORS Lee B, Lee S, Lee SK and Lee JW. TITLE The LIM-homeobox transcription factor Isl1 plays crucial roles in the development of multiple arcuate nucleus neurons JOURNAL Development 143 (20), 3763-3773 (2016) PUBMED 27578785 REFERENCE 5 (bases 1 to 875) AUTHORS Sokolowski K, Tran T, Esumi S, Kamal Y, Oboti L, Lischinsky J, Goodrich M, Lam A, Carter M, Nakagawa Y and Corbin JG. TITLE Molecular and behavioral profiling of Dbx1-derived neurons in the arcuate, lateral and ventromedial hypothalamic nuclei JOURNAL Neural Dev 11 (1), 12 (2016) PUBMED 27209204 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 875) AUTHORS Park SY, Kim JB and Han YM. TITLE REST is a key regulator in brain-specific homeobox gene expression during neuronal differentiation JOURNAL J Neurochem 103 (6), 2565-2574 (2007) PUBMED 17944879 REMARK GeneRIF: binding of REST to neuron restrictive silencer element suppresses transcriptional activator Sp1-mediated activation of bsx in non-neuronal cells REFERENCE 7 (bases 1 to 875) AUTHORS McArthur T and Ohtoshi A. TITLE A brain-specific homeobox gene, Bsx, is essential for proper postnatal growth and nursing JOURNAL Mol Cell Biol 27 (14), 5120-5127 (2007) PUBMED 17485440 REMARK GeneRIF: These results demonstrate that Bsx is required for postnatal growth and maintenance of lactating mammary glands. REFERENCE 8 (bases 1 to 875) AUTHORS Sakkou M, Wiedmer P, Anlag K, Hamm A, Seuntjens E, Ettwiller L, Tschop MH and Treier M. TITLE A role for brain-specific homeobox factor Bsx in the control of hyperphagia and locomotory behavior JOURNAL Cell Metab 5 (6), 450-463 (2007) PUBMED 17550780 REFERENCE 9 (bases 1 to 875) AUTHORS Chu HY and Ohtoshi A. TITLE Cloning and functional analysis of hypothalamic homeobox gene Bsx1a and its isoform, Bsx1b JOURNAL Mol Cell Biol 27 (10), 3743-3749 (2007) PUBMED 17353277 REMARK GeneRIF: Data demonstrate that BSX1A is a DNA binding protein and a transcriptional activator, and that BSX1A and BSX1B localize in the nuclei and cytoplasm, respectively. REFERENCE 10 (bases 1 to 875) AUTHORS Cremona M, Colombo E, Andreazzoli M, Cossu G and Broccoli V. TITLE Bsx, an evolutionary conserved Brain Specific homeoboX gene expressed in the septum, epiphysis, mammillary bodies and arcuate nucleus JOURNAL Gene Expr Patterns 4 (1), 47-51 (2004) PUBMED 14678827 REMARK GeneRIF: Might be considered an important molecular marker for early embryonic stages of epiphysis development. COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AC158355.2. On Nov 17, 2006 this sequence version replaced NM_178245.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AY233396.1, BC104387.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849378, SAMN01164137 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-313 AC158355.2 163549-163861 314-510 AC158355.2 165716-165912 511-875 AC158355.2 167030-167394 FEATURES Location/Qualifiers source 1..875 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="9" /map="9 21.65 cM" gene 1..875 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="brain specific homeobox" /db_xref="GeneID:244813" /db_xref="MGI:MGI:2669849" exon 1..313 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /inference="alignment:Splign:2.1.0" misc_feature 34..36 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="upstream in-frame stop codon" CDS 52..750 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /codon_start=1 /product="brain-specific homeobox protein homolog" /protein_id="NP_839976.1" /db_xref="CCDS:CCDS23084.1" /db_xref="GeneID:244813" /db_xref="MGI:MGI:2669849" /translation="
MNLNFTSPLHPASSQRPTSFFIEDILLHKPKPLREVAPDHFASSLASRVPLLDYGYPLMPTPTLLTPHAHHPLHKGDHHHPYFLTTSGMPVPALFPHPQHAELPGKHCRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDEPKAADGPESPEGSPRAPEGAPADARLSLPAGAFVLTEPEDEVDIGDEGELSSGPHVL"
misc_feature order(382..396,400..402,451..453,469..471,508..510, 514..519,526..531,535..543,547..552) /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(388..390,397..399,517..519,526..531,538..540) /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 391..549 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature 529..747 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /note="propagated from UniProtKB/Swiss-Prot (Q810B3.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 314..510 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /inference="alignment:Splign:2.1.0" exon 511..875 /gene="Bsx" /gene_synonym="Bsx1a; Bsx1b" /inference="alignment:Splign:2.1.0" ORIGIN
tgcttcctgcactttgtccgggccctcgccctgtgacaggcgctctgcaagatgaatctcaacttcacttcccctcttcatccagcatcttctcagaggcccacgtcgtttttcatcgaggacattctgctacacaagcccaagccgttgagggaagtggcccctgaccactttgccagctctctggcctctagggtgcctttgctagactatggctacccccttatgcccacacccaccctcctcacccctcacgctcatcatcctctgcataagggagatcaccaccatccttatttcctgaccacctcagggatgccggtcccggcgctgttcccgcacccgcagcacgcggagttgcccgggaagcactgccgccgccgcaaagctcgcacggtgttttctgactcgcagctctccggcctggagaaaaggttcgaaatccagcgctacctgtcgacgccagagcgtgtggagctggccactgccctcagcctctcagagactcaggtgaaaacgtggttccagaaccggcggatgaagcataaaaagcagctgaggaaaagccaagacgaaccgaaagcggcagacgggccggagagccccgaaggcagccctcgtgctcccgagggcgcgcccgccgacgctcggctgagcctgcccgccggtgccttcgtgcttactgagcccgaggacgaagtggacattggggatgaaggcgagctcagctcagggccgcatgtgctctgagtggccaggctgggaagggagacccgggcgaggaggccgcggggccagaccgggttcttcccgggtgggaagactcgcggagactccagactgctcctgcgacctgggctggaagaaagaaaggc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]