LOCUS       NM_029861               1614 bp    mRNA    linear   ROD 06-AUG-2023
DEFINITION  Mus musculus cannabinoid receptor interacting protein 1 (Cnrip1),
            mRNA.
ACCESSION   NM_029861 XM_354599
VERSION     NM_029861.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1614)
  AUTHORS   Gu SM, Seo S, Park D, Kim S, Lamichhane S, Han KM, Kim YH, Lee S,
            Hong JT, Cha HJ and Yun J.
  TITLE     Cannabinoid Receptor Type 1 Regulates Drug Reward Behavior via
            Glutamate Decarboxylase 67 Transcription
  JOURNAL   Int J Mol Sci 22 (19), 10486 (2021)
   PUBMED   34638827
  REMARK    GeneRIF: Cannabinoid Receptor Type 1 Regulates Drug Reward Behavior
            via Glutamate Decarboxylase 67 Transcription.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1614)
  AUTHORS   Booth WT, Clodfelter JE, Leone-Kabler S, Hughes EK, Eldeeb K,
            Howlett AC and Lowther WT.
  TITLE     Cannabinoid receptor interacting protein 1a interacts with
            myristoylated Galphai N terminus via a unique gapped beta-barrel
            structure
  JOURNAL   J Biol Chem 297 (3), 101099 (2021)
   PUBMED   34418434
  REMARK    GeneRIF: Cannabinoid receptor interacting protein 1a interacts with
            myristoylated Galphai N terminus via a unique gapped beta-barrel
            structure.
REFERENCE   3  (bases 1 to 1614)
  AUTHORS   Terral G, Busquets-Garcia A, Varilh M, Achicallende S, Cannich A,
            Bellocchio L, Bonilla-Del Rio I, Massa F, Puente N, Soria-Gomez E,
            Grandes P, Ferreira G and Marsicano G.
  TITLE     CB1 Receptors in the Anterior Piriform Cortex Control Odor
            Preference Memory
  JOURNAL   Curr Biol 29 (15), 2455-2464 (2019)
   PUBMED   31327715
  REMARK    GeneRIF: Pharmacological blockade or genetic deletion of anterior
            piriform cortex (aPC)-CB1 receptors specifically impaired the
            retrieval of conditioned odor preference. Interestingly, expression
            of conditioned odor aversion was unaffected by local CB1 receptor
            blockade, indicating that the role of aPC endocannabinoid signaling
            is selective for retrieval of appetitive memory.
REFERENCE   4  (bases 1 to 1614)
  AUTHORS   Miranda K, Mehrpouya-Bahrami P, Nagarkatti PS and Nagarkatti M.
  TITLE     Cannabinoid Receptor 1 Blockade Attenuates Obesity and Adipose
            Tissue Type 1 Inflammation Through miR-30e-5p Regulation of
            Delta-Like-4 in Macrophages and Consequently Downregulation of Th1
            Cells
  JOURNAL   Front Immunol 10, 1049 (2019)
   PUBMED   31134094
  REMARK    GeneRIF: these data demonstrate that blocking CB1 receptors leads
            to upregulation of miR-30e-5p and down regulation of DLL4 in
            adipose tissue macrophages, which in turn suppress DLL4-Notch
            signaling-induced polarization of inflammatory Th1 cells and
            adipocyte energy storage.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1614)
  AUTHORS   Papilloud A, Guillot de Suduiraut I, Zanoletti O, Grosse J and
            Sandi C.
  TITLE     Peripubertal stress increases play fighting at adolescence and
            modulates nucleus accumbens CB1 receptor expression and
            mitochondrial function in the amygdala
  JOURNAL   Transl Psychiatry 8 (1), 156 (2018)
   PUBMED   30111823
  REMARK    GeneRIF: peripubertal stress affects CB1 gene expression in the
            nucleus accumbens shell
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 1614)
  AUTHORS   Smith TH, Blume LC, Straiker A, Cox JO, David BG, McVoy JR, Sayers
            KW, Poklis JL, Abdullah RA, Egertova M, Chen CK, Mackie K, Elphick
            MR, Howlett AC and Selley DE.
  TITLE     Cannabinoid receptor-interacting protein 1a modulates CB1 receptor
            signaling and regulation
  JOURNAL   Mol Pharmacol 87 (4), 747-765 (2015)
   PUBMED   25657338
  REMARK    GeneRIF: CRIP1a appears to act as a broad negative regulator of CB1
            receptor function
REFERENCE   7  (bases 1 to 1614)
  AUTHORS   Blume LC, Eldeeb K, Bass CE, Selley DE and Howlett AC.
  TITLE     Cannabinoid receptor interacting protein (CRIP1a) attenuates CB1R
            signaling in neuronal cells
  JOURNAL   Cell Signal 27 (3), 716-726 (2015)
   PUBMED   25446256
  REMARK    GeneRIF: Endogenous levels of CRIP1a modulate CB1R-mediated signal
            transduction by facilitating a Gi/o protein subtype preference for
            Gi1 and Gi2, accompanied by an overall suppression of
            G-protein-mediated signaling in neuronal cells.
REFERENCE   8  (bases 1 to 1614)
  AUTHORS   Keimpema E, Barabas K, Morozov YM, Tortoriello G, Torii M, Cameron
            G, Yanagawa Y, Watanabe M, Mackie K and Harkany T.
  TITLE     Differential subcellular recruitment of monoacylglycerol lipase
            generates spatial specificity of 2-arachidonoyl glycerol signaling
            during axonal pathfinding
  JOURNAL   J Neurosci 30 (42), 13992-14007 (2010)
   PUBMED   20962221
REFERENCE   9  (bases 1 to 1614)
  AUTHORS   Werner HB, Kuhlmann K, Shen S, Uecker M, Schardt A, Dimova K,
            Orfaniotou F, Dhaunchak A, Brinkmann BG, Mobius W, Guarente L,
            Casaccia-Bonnefil P, Jahn O and Nave KA.
  TITLE     Proteolipid protein is required for transport of sirtuin 2 into CNS
            myelin
  JOURNAL   J Neurosci 27 (29), 7717-7730 (2007)
   PUBMED   17634366
REFERENCE   10 (bases 1 to 1614)
  AUTHORS   Wertz K and Herrmann BG.
  TITLE     Large-scale screen for genes involved in gonad development
  JOURNAL   Mech Dev 98 (1-2), 51-70 (2000)
   PUBMED   11044607
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL606466.12.
            
            On Aug 21, 2018 this sequence version replaced NM_029861.2.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC087946.1, AK171947.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-490               AL606466.12        108077-108566       c
            491-641             AL606466.12        105644-105794       c
            642-1614            AL606466.12        81053-82025         c
FEATURES             Location/Qualifiers
     source          1..1614
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 9.5 cM"
     gene            1..1614
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /note="cannabinoid receptor interacting protein 1"
                     /db_xref="GeneID:380686"
                     /db_xref="MGI:MGI:1917505"
     exon            1..490
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    138..140
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /note="upstream in-frame stop codon"
     CDS             312..806
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /note="CRIP-1"
                     /codon_start=1
                     /product="CB1 cannabinoid receptor-interacting protein 1"
                     /protein_id="NP_084137.1"
                     /db_xref="CCDS:CCDS24447.1"
                     /db_xref="GeneID:380686"
                     /db_xref="MGI:MGI:1917505"
                     /translation="

MGDLPGLVRLSIALRIQPNDGPVFFKVDGQRFGQNRTIKLLTGSSYKVEVKIKPTTLQVENISIGGVLVPLELKGKEPDGERVVYTGIYDTEGVAPTKSGERQPIQITMPFTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL"

     misc_feature    321..785
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /note="CB1 cannabinoid receptor-interacting protein 1;
                     Region: CNRIP1; pfam15043"
                     /db_xref="CDD:405692"
     exon            491..641
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /inference="alignment:Splign:2.1.0"
     exon            642..1614
                     /gene="Cnrip1"
                     /gene_synonym="1500041B16Rik; 3110054C06Rik;
                     5330437A18Rik; C2orf32"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agtgctgatttgcggggcagcctgccagtccagtcactgcgagccctcgcgtgcgtgcagggccctgcgtggggagcgggggatggggcagcctgctgcctccatgctgtctcttgggccggctccttttctgagtgtagtggagggccacagctgcttctcaaaatctggggtggacagaggcgaccgctcctagctgtggcctgcatccatccgctctctcttcctccctgcttgtcccctccgcccaaagcgccgcagcagctctctccagccttcactgtccaccactccagtctcggttgccaactatgggggacctacccggactcgtgcgcctttccatcgcgctgcgcatccagcccaacgacggccctgttttcttcaaggtggacgggcagcgttttggccagaaccgcacaatcaagctgctcaccggctcctcctacaaggtggaggtgaagattaagcccacaacactgcaggtcgagaacatttccattggtggtgtccttgtcccactggagctgaagggtaaagagcctgacggggagagagttgtctacaccggcatctatgacacagaaggtgtagccccaaccaaaagtggagagcgacaacccatccagatcaccatgcctttcacagacattgggaccttcgagacagtgtggcaagtcaaattctacaattaccacaagcgagaccattgccagtggggaagtcctttctctgtcattgagtatgaatgcaagcccaatgagacccgcagcctcatgtgggtgaataaggagtccttcctctgaaaatgattccttctgatgttgcaagacaatctccagaaactgacctttagacaaaccagcacaagccttaaccaaggcacaccacaccatggctgtttcccaatgacctcctacccccagttactgtgaaagtgtgactcccctctgatgcagtacccatgacatcacatgtaatgtcacattcctgaaagctctccttttgctattgtatgctggtgttcctgcatctatcctgtctgccagtgtgacaggagctcagtggaagtagcaggtttgtcctacaccaaagttccacagagagaccgtggtgttttgttttcaagataaataatttctcccttttgtgttcattgttaaattaagataacaatgtgctggagtccctcatgtgtgacttgtaacatgtagcatgcaatgtgtgtgagcatccaaaggtgactttgtgaaaaaaaatgtaacaacatggtctgcagtaaatgggacccaaatgttgtgcttcctattaacagctcggctgtttcagagaaaggaagataatgaaggaataaaaagatgaatatataagtaagtatttataatgtattaatagtatttcaagtagcaaggcattttgctgtggtctagtagaaatagggaaaagacattgttgtggaattggacctgtggctcatccctttggcaagctaccatagactttaaacaaacataaaggtggcactaatacataccctttaacttgaactttgtacaaccgtgtatggaatggtaatcaacttttgatatttcttaataaagacattggaaatga

//