LOCUS       NM_029061               1522 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus coiled-coil domain containing 7A (Ccdc7a), transcript
            variant 1, mRNA.
ACCESSION   NM_029061
VERSION     NM_029061.3
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1522)
  AUTHORS   Satoh A, Brace CS, Rensing N and Imai S.
  TITLE     Deficiency of Prdm13, a dorsomedial hypothalamus-enriched gene,
            mimics age-associated changes in sleep quality and adiposity
  JOURNAL   Aging Cell 14 (2), 209-218 (2015)
   PUBMED   25546159
REFERENCE   2  (bases 1 to 1522)
  AUTHORS   Zhou C, Zhang P, Xu GC, Wu DM, Liu RY, Zeng Q and Wang CT.
  TITLE     RNA interference of Biot2 induces G1 phase arrest and apoptosis in
            mouse colorectal cancer cell line
  JOURNAL   Oncol Res 22 (2), 93-103 (2015)
   PUBMED   25706396
  REMARK    GeneRIF: silencing Biot2 in CT26 cells by RNA interference can
            inhibit cell growth in vitro and in vivo.
REFERENCE   3  (bases 1 to 1522)
  AUTHORS   Satoh A, Brace CS, Rensing N, Cliften P, Wozniak DF, Herzog ED,
            Yamada KA and Imai S.
  TITLE     Sirt1 extends life span and delays aging in mice through the
            regulation of Nk2 homeobox 1 in the DMH and LH
  JOURNAL   Cell Metab 18 (3), 416-430 (2013)
   PUBMED   24011076
REFERENCE   4  (bases 1 to 1522)
  AUTHORS   Satoh A, Brace CS, Ben-Josef G, West T, Wozniak DF, Holtzman DM,
            Herzog ED and Imai S.
  TITLE     SIRT1 promotes the central adaptive response to diet restriction
            through activation of the dorsomedial and lateral nuclei of the
            hypothalamus
  JOURNAL   J Neurosci 30 (30), 10220-10232 (2010)
   PUBMED   20668205
REFERENCE   5  (bases 1 to 1522)
  AUTHORS   Wang H, Zhang P and Wang CT.
  TITLE     [Analysis of expression pattern of a novel testis-highly expressed
            gene Biot2-L and the primary study on its role in testis
            development]
  JOURNAL   Sichuan Da Xue Xue Bao Yi Xue Ban 40 (5), 853-856 (2009)
   PUBMED   19950598
  REMARK    GeneRIF: Biot2-L was highly expressed in adult testis, and its
            expression increased regularly during testis development.
REFERENCE   6  (bases 1 to 1522)
  AUTHORS   Wang CT, Zhang P, Wang YS, Ruan XZ, Li ZY, Peng F, Yang HS and Wei
            YQ.
  TITLE     RNA interference against Biot2, a novel mouse testis-specific gene,
            inhibits the growth of tumor cells
  JOURNAL   Cell Mol Biol Lett 14 (3), 363-376 (2009)
   PUBMED   19277478
  REMARK    GeneRIF: The Biot2 transcript was detected only and strongly in the
            testis tissues and abundantly in five types of murine cancer cell
            line.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AK016006.1 and AK015811.1.
            
            On Oct 2, 2010 this sequence version replaced NM_029061.2.
            
            Transcript Variant: This variant (1) represents the longer
            transcript and encodes the longer isoform (1).
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY854152.1, AK015811.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-19                AK016006.1         1-19
            20-1522             AK015811.1         2-1504
FEATURES             Location/Qualifiers
     source          1..1522
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="8"
                     /map="8 76.12 cM"
     gene            1..1522
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="coiled-coil domain containing 7A"
                     /db_xref="GeneID:74703"
                     /db_xref="MGI:MGI:1921953"
     exon            1..225
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            226..343
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    305..307
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="upstream in-frame stop codon"
     exon            344..667
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     CDS             395..1510
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="isoform 1 is encoded by transcript variant 1;
                     testis-specific antigen; putative cancer/testis antigen;
                     coiled-coil domain-containing protein 7; coiled-coil
                     domain containing 7"
                     /codon_start=1
                     /product="coiled-coil domain-containing protein 7 isoform
                     1"
                     /protein_id="NP_083337.1"
                     /db_xref="CCDS:CCDS40524.1"
                     /db_xref="GeneID:74703"
                     /db_xref="MGI:MGI:1921953"
                     /translation="

MKCAKHPSTISMKLTSVPELPYKKGLLNSSPKPKEKHNAKSKYGKNESMVLRSPPTGESIVRFALPIPLSKTKDKISADEMVRRITTNLKMVVSNLEDTYGACYDNGEKAAEKSEAEGLSIGDDVSSFLLCCSQFTSQLEEAVKEECGALESLYKWFQQQVNQMEEISKDQSNLEELQSDGKTASLNIVQIAKLARKFEDFKSRLKTRKEVMQTKNEDKEIMAETLKHYGLMEKQIEEFITSHSALESQTETESQSGTPSVTTRMARMIKIFENQSTMLEKALNDQQTIESKYKQLETDFQMLIMEKTLLEAEIRRLREIERVKSAAKEEQTKKSGKSEKKKFKEKEKYDMKICYLFIPQLVKMYLNHGLF"

     misc_feature    395..892
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="Spermatogenesis family BioT2; Region: BioT2;
                     pfam15368"
                     /db_xref="CDD:434670"
     misc_feature    455..547
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D541.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    <707..>1390
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
     exon            668..754
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            755..838
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            839..859
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            860..892
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            893..1044
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1045..1106
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1107..1163
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1164..1236
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1237..1267
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1268..1357
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
     exon            1358..1522
                     /gene="Ccdc7a"
                     /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik;
                     Biot2; Ccdc7; Gm3952"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggtcggttgttaccaccctgggcgcaaaggcccccctttccctttcagcacagatgtcagtttgtactggggcagagctgttgtctggagagtttgctggcatcttccaaagaggtgtaggaaacgcggaatttacaactttctcagacaaatagattctcaccttccagcctgccaccccaaagccaagccacccagtaagaccacttccaacagcctcagcagcattccgatcctccttgagagcaaatgatattcacatcaggtcatcatgtatacaattcaggacttaccttcagaatgatgaaagcacagagaggataacagatcctgcagcacaactggaggtactgaatttttcataagtaatttggaagctaaatcaatcacaaaaatgaaatgtgcaaagcatccatcaaccattagtatgaaattgacaagtgttccagaattaccttataagaaaggcttactgaattcatcacctaagccaaaagaaaaacataatgccaagtcaaagtatggtaaaaatgaatcaatggtcctgaggtcgccacccacaggagagtcaattgtacgctttgccttgccaataccattgagtaaaacgaaggacaaaatatcagctgatgaaatggtcaggaggattaccacaaatctgaagatggttgtttctaacttggaagacacctatggagcttgctatgataatggagaaaaagcagcagaaaaaagtgaagcagaaggcttgtctattggtgatgatgtgagttcgttcttgttgtgctgttcacaatttacatctcagctggaagaagcagttaaggaagaatgtggcgctttggagtctctttacaagtggtttcagcaacaagtcaaccaaatggaggagattagcaaggaccaaagtaatttagaagaacttcaatcagatggtaaaacggccagtttgaacattgtacaaattgcaaaactggcacgtaaattcgaagattttaaaagtcgcctaaaaacgcgcaaggaggtcatgcagactaaaaatgaggataaagagataatggcagaaacattgaaacattatggacttatggaaaagcagattgaagagttcataacatcccattcagctttagaatctcaaactgaaactgaaagtcagtcaggaactccttcagtgactactcggatggccaggatgataaaaatatttgaaaatcagtcaactatgttagagaaagctttaaatgatcagcaaacaattgagtctaaatataaacagttggaaactgattttcaaatgttaataatggagaaaaccctgctggaagcagaaatacgaaggctgagagaaatagagagagtaaagtctgcagccaaagaagagcaaaccaagaaatctggaaaatcagaaaagaaaaaatttaaagagaaggaaaagtacgacatgaagatatgttatctttttattcctcaacttgtaaaaatgtaccttaatcacggtttattttaaaataaaaataac

//