GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 00:58:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_028849                619 bp    mRNA    linear   ROD 02-MAY-2024
DEFINITION  Mus musculus claudin domain containing 2 (Cldnd2), transcript
            variant 1, mRNA.
ACCESSION   NM_028849 XM_001001597 XM_133406 XM_914178
VERSION     NM_028849.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 619)
  AUTHORS   Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
            Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
            Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
            Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
            Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
            Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
            Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
            Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
            Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
            Jackson,S.P. and Balmus,G.
  CONSRTM   Sanger Mouse Genetics Project
  TITLE     Genetic determinants of micronucleus formation in vivo
  JOURNAL   Nature 627 (8002), 130-136 (2024)
   PUBMED   38355793
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC149091.3 and AC154108.3.
            
            On Mar 24, 2023 this sequence version replaced NM_028849.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC128277.1, AK006929.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN00849384
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-58                AC149091.3         240652-240709
            59-240              AC154108.3         203088-203269       c
            241-381             AC154108.3         202596-202736       c
            382-501             AC154108.3         201932-202051       c
            502-619             AC154108.3         201568-201685       c
FEATURES             Location/Qualifiers
     source          1..619
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 28.25 cM"
     gene            1..619
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="claudin domain containing 2"
                     /db_xref="GeneID:74276"
                     /db_xref="MGI:MGI:1921526"
     exon            1..58
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            59..240
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /inference="alignment:Splign:2.1.0"
     CDS             72..575
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="isoform 1 is encoded by transcript variant 1;
                     claudin domain-containing protein 2"
                     /codon_start=1
                     /product="claudin domain-containing protein 2 isoform 1"
                     /protein_id="NP_083125.1"
                     /db_xref="CCDS:CCDS39929.1"
                     /db_xref="GeneID:74276"
                     /db_xref="MGI:MGI:1921526"
                     /translation="
MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL"
     misc_feature    108..167
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1);
                     transmembrane region"
     misc_feature    138..503
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    252..314
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1);
                     transmembrane region"
     misc_feature    357..419
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1);
                     transmembrane region"
     misc_feature    459..521
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9D9H2.1);
                     transmembrane region"
     exon            241..381
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            382..501
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /inference="alignment:Splign:2.1.0"
     exon            502..619
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /inference="alignment:Splign:2.1.0"
     regulatory      596..601
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="hexamer: AATAAA"
     polyA_site      619
                     /gene="Cldnd2"
                     /gene_synonym="1700071E18Rik"
                     /note="major polyA site"
ORIGIN      
agagaaccatcctcccttcccccaaccccgcgggctctttgtcgcaggggaccaggctctgcctccttggcatgggggtgaagaagagccttcagactggagggaatttacttaatctcttgagcagcatcctcacagtactgtctactaccaccaactactggacccgacagcaaggggggcacagtggcctatggcaggagtgtacccatggcaaatgctccaacatcccctgccagaacaccgtggcagtgtccgcagcgtgcatggtgttggcagcaaccttcagtattgtagctttggggatcgggataaggattcagtgtcgagaggcagagtcacgacgtagccagaataccattgtcttacttttcctcagcgggttgctgctgctgattgccttggccgtatacacttcaaagaatgcctggaagccagaagtcttcttctcctggtcctactttttcggatggttggctttacccttcttgtttattgcgggcttctgctttctgcttgccgacatgatcttgcagagcaccgaagccatcagcggattcccggtatgcctatgaatgcggcctgcctggggcagaataaaggaatggcttttagcctc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]