LOCUS       NM_024439               1208 bp    mRNA    linear   ROD 19-DEC-2022
DEFINITION  Mus musculus selenoprotein S (Selenos), transcript variant 1, mRNA.
ACCESSION   NM_024439
VERSION     NM_024439.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1208)
  AUTHORS   Qiao L, Men L, Yu S, Yao J, Li Y, Wang M, Yu Y, Wang N, Ran L, Wu Y
            and Du J.
  TITLE     Hepatic deficiency of selenoprotein S exacerbates hepatic steatosis
            and insulin resistance
  JOURNAL   Cell Death Dis 13 (3), 275 (2022)
   PUBMED   35347118
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1208)
  AUTHORS   Addinsall AB, Wright CR, Kotsiakos TL, Smith ZM, Cook TR,
            Andrikopoulos S, van der Poel C and Stupka N.
  TITLE     Impaired exercise performance is independent of inflammation and
            cellular stress following genetic reduction or deletion of
            selenoprotein S
  JOURNAL   Am J Physiol Regul Integr Comp Physiol 318 (5), R981-R996 (2020)
   PUBMED   32186893
  REMARK    GeneRIF: Impaired exercise performance with Seps1 reduction or
            deletion cannot be attributed to heightened cellular stress or
            inflammation, but it may potentially be mediated, in part, by the
            effects of Seps1 on the microvasculature.
REFERENCE   3  (bases 1 to 1208)
  AUTHORS   Men L, Yao J, Yu S, Li Y, Cui S, Jin S, Zhang G, Ren D and Du J.
  TITLE     Selenoprotein S regulates adipogenesis through IRE1alpha-XBP1
            pathway
  JOURNAL   J Endocrinol 244 (3), 431-443 (2020)
   PUBMED   31846435
  REMARK    GeneRIF: Selenoprotein S regulates adipogenesis through
            IRE1alpha-XBP1 pathway.
REFERENCE   4  (bases 1 to 1208)
  AUTHORS   Men L, Sun J and Ren D.
  TITLE     Deficiency of VCP-Interacting Membrane Selenoprotein (VIMP) Leads
            to G1 Cell Cycle Arrest and Cell Death in MIN6 Insulinoma Cells
  JOURNAL   Cell Physiol Biochem 51 (5), 2185-2197 (2018)
   PUBMED   30537728
  REMARK    GeneRIF: These results suggest that VIMP may function as a novel
            regulator to modulate beta-cell survival, proliferation, cell
            cycle, unfolded protein response and insulin secretion in MIN6
            cells. VIMP knockdown (KD) decreases cell proliferation and G1 cell
            cycle arrest.
REFERENCE   5  (bases 1 to 1208)
  AUTHORS   Gladyshev VN, Arner ES, Berry MJ, Brigelius-Flohe R, Bruford EA,
            Burk RF, Carlson BA, Castellano S, Chavatte L, Conrad M, Copeland
            PR, Diamond AM, Driscoll DM, Ferreiro A, Flohe L, Green FR, Guigo
            R, Handy DE, Hatfield DL, Hesketh J, Hoffmann PR, Holmgren A,
            Hondal RJ, Howard MT, Huang K, Kim HY, Kim IY, Kohrle J, Krol A,
            Kryukov GV, Lee BJ, Lee BC, Lei XG, Liu Q, Lescure A, Lobanov AV,
            Loscalzo J, Maiorino M, Mariotti M, Sandeep Prabhu K, Rayman MP,
            Rozovsky S, Salinas G, Schmidt EE, Schomburg L, Schweizer U,
            Simonovic M, Sunde RA, Tsuji PA, Tweedie S, Ursini F, Whanger PD
            and Zhang Y.
  TITLE     Selenoprotein Gene Nomenclature
  JOURNAL   J Biol Chem 291 (46), 24036-24040 (2016)
   PUBMED   27645994
REFERENCE   6  (bases 1 to 1208)
  AUTHORS   Bubenik JL, Miniard AC and Driscoll DM.
  TITLE     Alternative transcripts and 3'UTR elements govern the incorporation
            of selenocysteine into selenoprotein S
  JOURNAL   PLoS One 8 (4), e62102 (2013)
   PUBMED   23614019
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1208)
  AUTHORS   Fradejas N, Pastor MD, Mora-Lee S, Tranque P and Calvo S.
  TITLE     SEPS1 gene is activated during astrocyte ischemia and shows
            prominent antiapoptotic effects
  JOURNAL   J Mol Neurosci 35 (3), 259-265 (2008)
   PUBMED   18498015
  REMARK    GeneRIF: We found that suppression of SEPS1 by small interfering
            RNA severely increases astrocyte injure caused by OGD, suggesting
            that selenoprotein S protects astrocytes against ischemia.
REFERENCE   8  (bases 1 to 1208)
  AUTHORS   Kim KH, Gao Y, Walder K, Collier GR, Skelton J and Kissebah AH.
  TITLE     SEPS1 protects RAW264.7 cells from pharmacological ER stress
            agent-induced apoptosis
  JOURNAL   Biochem Biophys Res Commun 354 (1), 127-132 (2007)
   PUBMED   17210132
  REMARK    GeneRIF: These findings suggest that SEPS1 could be a new ER
            stress-dependent survival factor that protects macrophage against
            ER stress-induced cellular dysfunction.
REFERENCE   9  (bases 1 to 1208)
  AUTHORS   Curran JE, Jowett JB, Elliott KS, Gao Y, Gluschenko K, Wang J, Abel
            Azim DM, Cai G, Mahaney MC, Comuzzie AG, Dyer TD, Walder KR, Zimmet
            P, MacCluer JW, Collier GR, Kissebah AH and Blangero J.
  TITLE     Genetic variation in selenoprotein S influences inflammatory
            response
  JOURNAL   Nat Genet 37 (11), 1234-1241 (2005)
   PUBMED   16227999
REFERENCE   10 (bases 1 to 1208)
  AUTHORS   Kryukov GV, Castellano S, Novoselov SV, Lobanov AV, Zehtab O, Guigo
            R and Gladyshev VN.
  TITLE     Characterization of mammalian selenoproteomes
  JOURNAL   Science 300 (5624), 1439-1443 (2003)
   PUBMED   12775843
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BY335100.1, AK005204.1 and
            AI836862.1.
            
            On Aug 2, 2006 this sequence version replaced NM_024439.2.
            
            Summary: This gene encodes a transmembrane protein that is
            localized in the endoplasmic reticulum (ER). It is involved in the
            degradation process of misfolded proteins in the ER, and may also
            have a role in inflammation control. This protein is a
            selenoprotein, containing the rare amino acid selenocysteine (Sec).
            Sec is encoded by the UGA codon, which normally signals translation
            termination. The 3' UTRs of selenoprotein mRNAs contain a conserved
            stem-loop structure, designated the Sec insertion sequence (SECIS)
            element, that is necessary for the recognition of UGA as a Sec
            codon, rather than as a stop signal. Two additional
            phylogenetically conserved stem-loop structures (Stem-loop 1 and
            Stem-loop 2) in the 3' UTR of this mRNA have been shown to function
            as modulators of Sec insertion (PMID:23614019). Alternatively
            spliced transcript variants have been found for this gene.
            [provided by RefSeq, Jul 2017].
            
            Transcript Variant: This variant (1) represents the predominant
            transcript and encodes the longer isoform (1).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF335543.1, BC011091.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849375, SAMN00849380
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            protein contains selenocysteine :: PMID: 12775843
            RefSeq Select criteria          :: based on conservation,
                                               expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-18                BY335100.1         3-20
            19-1075             AK005204.1         2-1058
            1076-1208           AI836862.1         1-133               c
FEATURES             Location/Qualifiers
     source          1..1208
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="7"
                     /map="7 35.49 cM"
     gene            1..1208
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="selenoprotein S"
                     /db_xref="GeneID:109815"
                     /db_xref="MGI:MGI:95994"
     exon            1..141
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     CDS             66..638
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="UGA stop codon recoded as selenocysteine; isoform 1
                     is encoded by transcript variant 1; VCP-interacting
                     membrane protein; minor histocompatibility antigen H47"
                     /codon_start=1
                     /transl_except=(pos:630..632,aa:Sec)
                     /product="selenoprotein S isoform 1"
                     /protein_id="NP_077759.3"
                     /db_xref="CCDS:CCDS39977.1"
                     /db_xref="GeneID:109815"
                     /db_xref="MGI:MGI:95994"
                     /translation="

MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQRQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGGUN"

     misc_feature    66..629
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:429198"
     misc_feature    147..209
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BCZ4.3);
                     transmembrane region"
     misc_feature    297..335
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BCZ4.3);
                     Region: VCP/p97-interacting motif (VIM).
                     /evidence=ECO:0000250|UniProtKB:Q9BQE4"
     misc_feature    408..635
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9BCZ4.3);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    630..632
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Selenocysteine; other site"
     exon            142..276
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            277..383
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            384..473
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            474..552
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     exon            553..1191
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /inference="alignment:Splign:2.1.0"
     regulatory      641..673
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="Stem-loop 1"
                     /function="promotes selenocysteine insertion"
     regulatory      952..1039
                     /regulatory_class="recoding_stimulatory_region"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="SECIS_element"
                     /function="essential for recoding UGA to specify
                     selenocysteine"
     regulatory      1044..1070
                     /regulatory_class="other"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
                     /note="recoding_inhibitory_region; Stem-loop 2"
                     /function="inhibits selenocysteine insertion"
     regulatory      1127..1132
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
     polyA_site      1191
                     /gene="Selenos"
                     /gene_synonym="1500011E07Rik; H-4; H-47; H4; H47; Sels;
                     Seps1; Vimp"
ORIGIN      

gaaccggaagcgcagagcagagaggagcagcgggcttgtcgttggtggcggtggcggtggccgccatggatcgcgatgaggaacctctgtccgcgaggccggcgctggagaccgagagcctgcgattcctgcacgtgacagtgggctccctgctggccagctatggctggtacatcctcttcagctgcatcctactctacattgtcatccagaggctctcccttcgactgagggctttgaggcagagacagctggaccaagccgagactgttctggaacctgatgttgttgttaagcggcaagaggctttagcagctgctcgtttgagaatgcaggaagatctaaatgcccaagttgaaaaacataaggaaaaactaagacagcttgaagaagagaaaagaagacagaagattgaaatgtgggacagcatgcaagaaggcagaagttacaaaagaaattcaggaaggcctcaggaagaagatggtcctggaccttctacttcatctgtcatccccaaaggaaaatctgacaaaaagcctttgcgaggaggtggttataaccctctgacgggtgaagggggtggaacctgctcctggagacctggacgcaggggcccatcatctggcggctgaaactaagactcttgttagtgtcgctctgacattagcaaggtgaacctttaaccctcaactcaattgccttacgcacactttcacagtgactggccaaggagaggtggggcttttctctgttctaaactacttgtactttaagggctttggtcagcatgagatatagacattgccattaggccacactctagacaagacagccatggcttttatggctgctggctagttggtaggttgaaggcttcttgctgtttagcagacttcataaagaaggcccagtgatgatactttggggtagaagtccttgctggcaggatggtctctgtgacgggatgcgttgaatgatgtcttccttataaatggtgaacccaccagtgaggattactgatgttcacagttgacggggtttgcttctgtatatttattttatgtacagaactttgtaaaaaaaaaaaaaagttaaatacttaaaaagtaacatttttagcatctttattaaactcaaggaaatttctttgtgagcttgactttgtcagacagtaaacagctttgtatcattaaaaaaaaaaaaaaaaa

//