2024-05-05 23:50:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_011292 737 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus ribosomal protein L9 (Rpl9), mRNA. ACCESSION NM_011292 VERSION NM_011292.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 737) AUTHORS Li H, Huo Y, He X, Yao L, Zhang H, Cui Y, Xiao H, Xie W, Zhang D, Wang Y, Zhang S, Tu H, Cheng Y, Guo Y, Cao X, Zhu Y, Jiang T, Guo X, Qin Y and Sha J. TITLE A male germ-cell-specific ribosome controls male fertility JOURNAL Nature 612 (7941), 725-731 (2022) PUBMED 36517592 REFERENCE 2 (bases 1 to 737) AUTHORS Watanabe M, Toyomura T, Wake H, Nishinaka T, Hatipoglu OF, Takahashi H, Nishibori M and Mori S. TITLE Identification of ribosomal protein L9 as a novel regulator of proinflammatory damage-associated molecular pattern molecules JOURNAL Mol Biol Rep 49 (4), 2831-2838 (2022) PUBMED 35059969 REMARK GeneRIF: Identification of ribosomal protein L9 as a novel regulator of proinflammatory damage-associated molecular pattern molecules. REFERENCE 3 (bases 1 to 737) AUTHORS Khatter H, Myasnikov AG, Natchiar SK and Klaholz BP. TITLE Structure of the human 80S ribosome JOURNAL Nature 520 (7549), 640-645 (2015) PUBMED 25901680 REFERENCE 4 (bases 1 to 737) AUTHORS Beyer AR, Bann DV, Rice B, Pultz IS, Kane M, Goff SP, Golovkina TV and Parent LJ. TITLE Nucleolar trafficking of the mouse mammary tumor virus gag protein induced by interaction with ribosomal protein L9 JOURNAL J Virol 87 (2), 1069-1082 (2013) PUBMED 23135726 REMARK GeneRIF: These data support the hypothesis that efficient mouse mammary tumor virus particle assembly is dependent upon the interaction of Gag and L9 in the nucleoli of infected cells. REFERENCE 5 (bases 1 to 737) AUTHORS Kondrashov N, Pusic A, Stumpf CR, Shimizu K, Hsieh AC, Ishijima J, Shiroishi T and Barna M. TITLE Ribosome-mediated specificity in Hox mRNA translation and vertebrate tissue patterning JOURNAL Cell 145 (3), 383-397 (2011) PUBMED 21529712 REFERENCE 6 (bases 1 to 737) AUTHORS Trinidad JC, Specht CG, Thalhammer A, Schoepfer R and Burlingame AL. TITLE Comprehensive identification of phosphorylation sites in postsynaptic density preparations JOURNAL Mol Cell Proteomics 5 (5), 914-922 (2006) PUBMED 16452087 REFERENCE 7 (bases 1 to 737) AUTHORS Ko MS, Threat TA, Wang X, Horton JH, Cui Y, Wang X, Pryor E, Paris J, Wells-Smith J, Kitchen JR, Rowe LB, Eppig J, Satoh T, Brant L, Fujiwara H, Yotsumoto S and Nakashima H. TITLE Genome-wide mapping of unselected transcripts from extraembryonic tissue of 7.5-day mouse embryos reveals enrichment in the t-complex and under-representation on the X chromosome JOURNAL Hum Mol Genet 7 (12), 1967-1978 (1998) PUBMED 9811942 REFERENCE 8 (bases 1 to 737) AUTHORS Monach PA, Meredith SC, Siegel CT and Schreiber H. TITLE A unique tumor antigen produced by a single amino acid substitution JOURNAL Immunity 2 (1), 45-59 (1995) PUBMED 7600302 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BY072215.1 and BC089319.1. On Jul 24, 2008 this sequence version replaced NM_011292.1. ##Evidence-Data-START## Transcript exon combination :: BC086937.1, CF949991.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN00849374, SAMN00849375 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-51 BY072215.1 2-52 52-737 BC089319.1 1-686 FEATURES Location/Qualifiers source 1..737 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="5" /map="5 33.66 cM" gene 1..737 /gene="Rpl9" /note="ribosomal protein L9" /db_xref="GeneID:20005" /db_xref="MGI:MGI:1298373" exon 1..56 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 57..103 /gene="Rpl9" /inference="alignment:Splign:2.1.0" CDS 58..636 /gene="Rpl9" /note="60S ribosomal protein L9" /codon_start=1 /product="large ribosomal subunit protein uL6" /protein_id="NP_035422.1" /db_xref="CCDS:CCDS39097.1" /db_xref="GeneID:20005" /db_xref="MGI:MGI:1298373" /translation="
MKTILSNQTVDIPENVEITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGFRYKMRSVYAHFPINVVIQENGSLVEIRNFLGEKYIRRVRMRTGVACSVSQAQKDELILEGNDIELVSNSAALIQQATTVKNKDIRKFLDGIYVSEKGTVQQADE"
misc_feature 58..630 /gene="Rpl9" /note="60S ribosomal protein L6; Provisional; Region: PTZ00027" /db_xref="CDD:240234" misc_feature 418..420 /gene="Rpl9" /note="N6-acetyllysine. /evidence=ECO:0000250|UniProtKB:P32969; propagated from UniProtKB/Swiss-Prot (P51410.2); acetylation site" exon 104..219 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 220..315 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 316..448 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 449..529 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 530..647 /gene="Rpl9" /inference="alignment:Splign:2.1.0" exon 648..725 /gene="Rpl9" /inference="alignment:Splign:2.1.0" ORIGIN
ggattacaagaacgtgatgacgaaagacgttctctctttgccccatctactgcgaggatgaagaccattctcagcaatcagactgtggacattccagagaatgtcgaaatcactctgaaggggcgcacagtcattgtgaagggccccagggggactctgcggagggacttcaatcacatcaacgtggagctgagtcttcttgggaagaagaagaaaaggctccgggttgacaaatggtggggtaacagaaaggaactggccaccgtcaggaccatctgcagtcatgttcagaacatgatcaagggtgtcacgctgggcttccgatacaagatgcggtctgtgtacgctcacttccccatcaacgtcgtcatccaggagaatggctctttggttgaaatccgaaatttcttgggtgaaaaatacatccgcagggttcggatgaggacaggtgtggcttgttctgtctctcaagcccagaaggatgagttaatccttgaaggaaatgacattgaacttgtttcaaattcagctgccctgattcagcaagccacaacagttaaaaacaaggatatcaggaagtttttggacggcatctatgtgtctgagaagggaactgtgcagcaggctgacgagtgaggaggcctcagttcctggccccagaaacgagatcctgaccacatgaacaatttgggctcttttgggagaataaaagacttatatattgaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]