ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-18 20:56:00, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_010649 1257 bp mRNA linear ROD 01-MAY-2025
DEFINITION Mus musculus killer cell lectin-like receptor, subfamily A, member
4 (Klra4), transcript variant 1, mRNA.
ACCESSION NM_010649 XM_918374
VERSION NM_010649.4
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 1257)
AUTHORS Nabekura,T. and Lanier,L.L.
TITLE Activating Receptors for Self-MHC Class I Enhance Effector
Functions and Memory Differentiation of NK Cells during Mouse
Cytomegalovirus Infection
JOURNAL Immunity 45 (1), 74-82 (2016)
PUBMED 27438766
REMARK GeneRIF: this study shows that after mouse cytomegalovirus
infection, Ly49D augmented IFN-gamma production by virus-specific
Ly49H(+) NK cells and preferentially promoted the generation of
memory Ly49H(+) NK cells
REFERENCE 2 (bases 1 to 1257)
AUTHORS Liu,J., Liu,S., Xia,M., Xu,S., Wang,C., Bao,Y., Jiang,M., Wu,Y.,
Xu,T. and Cao,X.
TITLE Rhomboid domain-containing protein 3 is a negative regulator of
TLR3-triggered natural killer cell activation
JOURNAL Proc Natl Acad Sci U S A 110 (19), 7814-7819 (2013)
PUBMED 23610400
REFERENCE 3 (bases 1 to 1257)
AUTHORS Schenkel,A.R., Kingry,L.C. and Slayden,R.A.
TITLE The ly49 gene family. A brief guide to the nomenclature, genetics,
and role in intracellular infection
JOURNAL Front Immunol 4, 90 (2013)
PUBMED 23596445
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1257)
AUTHORS Tassi,I., Le Friec,G., Gilfillan,S., Takai,T., Yokoyama,W.M. and
Colonna,M.
TITLE DAP10 associates with Ly49 receptors but contributes minimally to
their expression and function in vivo
JOURNAL Eur J Immunol 39 (4), 1129-1135 (2009)
PUBMED 19247984
REMARK GeneRIF: these data demonstrate that DAP10 does associate with
Ly49H and Ly49D in primary NK cells.
REFERENCE 5 (bases 1 to 1257)
AUTHORS Merck,E., Voyle,R.B. and MacDonald,H.R.
TITLE Ly49D engagement on T lymphocytes induces TCR-independent
activation and CD8 effector functions that control tumor growth
JOURNAL J Immunol 182 (1), 183-192 (2009)
PUBMED 19109149
REMARK GeneRIF: Ly49D stimulation triggers cellular activation of CD4 and
CD8 populations; Ly49D recognizes the classical hamster class I
molecule Hm1-C4 on CHO cells, as demonstrated by the killing of
Hm1-C4-transfected thymoma cells by Ly49D cytotoxic T cells.
REFERENCE 6 (bases 1 to 1257)
AUTHORS Yokoyama,W.M.
TITLE Hybrid resistance and the Ly-49 family of natural killer cell
receptors
JOURNAL J Exp Med 182 (2), 273-277 (1995)
PUBMED 7629493
REMARK Review article
REFERENCE 7 (bases 1 to 1257)
AUTHORS Smith,H.R., Karlhofer,F.M. and Yokoyama,W.M.
TITLE Ly-49 multigene family expressed by IL-2-activated NK cells
JOURNAL J Immunol 153 (3), 1068-1079 (1994)
PUBMED 8027540
REFERENCE 8 (bases 1 to 1257)
AUTHORS Morse,H.C. 3rd.
TITLE Genetic nomenclature for loci controlling surface antigens of mouse
hemopoietic cells
JOURNAL J Immunol 149 (10), 3129-3134 (1992)
PUBMED 1431091
REMARK Review article
Erratum:[J Immunol 1993 Mar 15;150(6):2563]
REFERENCE 9 (bases 1 to 1257)
AUTHORS Wong,S., Freeman,J.D., Kelleher,C., Mager,D. and Takei,F.
TITLE Ly-49 multigene family. New members of a superfamily of type II
membrane proteins with lectin-like domains
JOURNAL J Immunol 147 (4), 1417-1423 (1991)
PUBMED 1869832
REFERENCE 10 (bases 1 to 1257)
AUTHORS Yokoyama,W.M., Kehn,P.J., Cohen,D.I. and Shevach,E.M.
TITLE Chromosomal location of the Ly-49 (A1, YE1/48) multigene family.
Genetic association with the NK 1.1 antigen
JOURNAL J Immunol 145 (7), 2353-2358 (1990)
PUBMED 1975828
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC090127.11 and AC090563.17.
On Sep 7, 2022 this sequence version replaced NM_010649.3.
Transcript Variant: This variant (1) encodes the shorter isoform
(1).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U10090.1, SRR13422601.366632.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849388, SAMN01164133
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-113 AC090127.11 159091-159203
114-277 AC090127.11 161016-161179
278-358 AC090127.11 163184-163264
359-565 AC090127.11 164145-164351
566-708 AC090127.11 166705-166847
709-812 AC090563.17 199734-199837 c
813-1257 AC090563.17 190499-190943 c
FEATURES Location/Qualifiers
source 1..1257
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="6"
/map="6 63.44 cM"
gene 1..1257
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="killer cell lectin-like receptor, subfamily A,
member 4"
/db_xref="GeneID:16635"
/db_xref="MGI:MGI:101904"
exon 1..113
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
misc_feature 103..105
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="upstream in-frame stop codon"
exon 114..277
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
CDS 166..948
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="isoform 1 is encoded by transcript variant 1;
killer cell lectin-like receptor 4; killer cell
lectin-like receptor subfamily A member 32; lymphocyte
antigen 49d; T-cell surface glycoprotein Ly-49D; killer
cell lectin-like receptor subfamily A member 33"
/codon_start=1
/product="killer cell lectin-like receptor 4 isoform 1"
/protein_id="NP_034779.1"
/db_xref="GeneID:16635"
/db_xref="MGI:MGI:101904"
/translation="
MTEQEDTFSAVRFHKSSGLQNEMRLKETRKPEKARLRVPWQLIVIALGILISLRLVTVAVLMTNIFQYGQQKHELKEFLKHHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQNILCDKTRTVLDYLQHTGRGVKVYWFCYGMKCYYFVMDRKPWSRCKQSCQNSSLTLLKIDDEDELKFLQLVVPSDSCWIGLSYDNKKKDWAWIDNRPSKLALNTTKYNIRDGGCMFLSKTRLDNNYCDQSFICICGKRLDKFPH"
misc_feature 277..618
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="Ly49-like protein, N-terminal region; Region: Ly49;
pfam08391"
/db_xref="CDD:462461"
misc_feature 289..351
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="propagated from UniProtKB/Swiss-Prot (Q60651.2);
transmembrane region"
misc_feature 415..417
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
misc_feature 466..468
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
misc_feature 583..924
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="C-type lectin-like domain (CTLD) of the type found
in natural killer cell receptors (NKRs); Region:
CLECT_NK_receptors_like; cd03593"
/db_xref="CDD:153063"
misc_feature 664..666
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
misc_feature order(739..741,820..822,874..876,880..885)
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="ligand binding surface [chemical binding]; other
site"
/db_xref="CDD:153063"
misc_feature 820..822
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="N-linked (GlcNAc...) asparagine.
/evidence=ECO:0000255; propagated from
UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
exon 278..358
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
exon 359..565
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
exon 566..708
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
exon 709..812
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
exon 813..1257
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/inference="alignment:Splign:2.1.0"
regulatory 1237..1242
/regulatory_class="polyA_signal_sequence"
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="hexamer: AATAAA"
polyA_site 1257
/gene="Klra4"
/gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
ly49r<129>"
/note="major polyA site"
ORIGIN
agttctgcctttcttcttggagcctctaaggggatacacaccagaaaaggcccacattaccccaacagggacatccattccttctacccacctcacttcaggtagagtcacagaaatcactcaaggacatattttaaaagagaacatactctacatactcccaagatgactgaacaggaagacactttctcagctgtgagattccataagtcttcagggttgcagaacgagatgaggctcaaggagacacggaagcctgaaaaagctcgcctcagagttccctggcagctcattgtgatagctctcgggatcctcatttcccttcgactggtaactgttgcagtgcttatgacaaacatttttcagtatggtcaacaaaaacatgaactgaaggaatttctaaaacaccacaataactgcagcatcatgcaaagtgacatcaacttgaaggatgaactgctgaaaaataagtctatagagtgtaatcttctggaatccctcaacagggatcaaaacatactgtgtgataaaaccaggactgttttagattacttacagcacacaggcagaggtgttaaagtatactggttctgttatggtatgaaatgttattatttcgtcatggacagaaaaccatggagtagatgtaaacagagctgccagaattccagcttaacccttctgaagatagatgatgaggatgaactgaagttccttcagctcgtggttccttcagacagttgctggattggattgtcatatgataataagaaaaaagattgggcatggattgacaatcgcccatctaaacttgccttgaacacaacgaaatacaatataagagatggaggatgtatgttcttatctaaaactagactagacaataattactgtgatcaatcattcatctgtatttgtgggaagagattggacaaattccctcattgactctccagtgagtgttaaaagtaaaaaaaaaaaaaaatgaaaatttctgactctcatttgtttcctgtaataattcatgactccttagaaacaagtgcttgaccattggacatagtctgcagtgcaaagagagagacaatctggaagattttgggaatgttctctgaaacatgacatgaaagagcagaggatatcttccttccctgtggagactggacagatcttctctggtcccgcaaaacttgaatgaatctgatttatttgtttgcataaactccaatagaattaaataaaggatcttaataacca
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]