2024-04-29 22:56:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_009639 1436 bp mRNA linear ROD 12-NOV-2023 DEFINITION Mus musculus cysteine-rich secretory protein 3 (Crisp3), mRNA. ACCESSION NM_009639 XM_001002056 VERSION NM_009639.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1436) AUTHORS Curci L, Brukman NG, Weigel Munoz M, Rojo D, Carvajal G, Sulzyk V, Gonzalez SN, Rubinstein M, Da Ros VG and Cuasnicu PS. TITLE Functional redundancy and compensation: Deletion of multiple murine Crisp genes reveals their essential role for male fertility JOURNAL FASEB J 34 (12), 15718-15733 (2020) PUBMED 33037689 REFERENCE 2 (bases 1 to 1436) AUTHORS Evans J, D'Sylva R, Volpert M, Jamsai D, Merriner DJ, Nie G, Salamonsen LA and O'Bryan MK. TITLE Endometrial CRISP3 is regulated throughout the mouse estrous and human menstrual cycle and facilitates adhesion and proliferation of endometrial epithelial cells JOURNAL Biol Reprod 92 (4), 99 (2015) PUBMED 25715794 REMARK GeneRIF: These data suggest roles for epithelial and neutrophil-derived CRISP3 in endometrial repair and regeneration REFERENCE 3 (bases 1 to 1436) AUTHORS Islam MN, Itoh S, Yanagita T, Sumiyoshi K, Hayano S, Kuremoto K, Kurosaka H, Honjo T, Kawanabe N, Kamioka H, Sakai T, Ishimaru N, Taniuchi I and Yamashiro T. TITLE Runx/Cbfb signaling regulates postnatal development of granular convoluted tubule in the mouse submandibular gland JOURNAL Dev Dyn 244 (3), 488-496 (2015) PUBMED 25410786 REFERENCE 4 (bases 1 to 1436) AUTHORS Dike S, Balija VS, Nascimento LU, Xuan Z, Ou J, Zutavern T, Palmer LE, Hannon G, Zhang MQ and McCombie WR. TITLE The mouse genome: experimental examination of gene predictions and transcriptional start sites JOURNAL Genome Res 14 (12), 2424-2429 (2004) PUBMED 15574821 REFERENCE 5 (bases 1 to 1436) AUTHORS Ruchon AF, Tenenhouse HS, Marcinkiewicz M, Siegfried G, Aubin JE, DesGroseillers L, Crine P and Boileau G. TITLE Developmental expression and tissue distribution of Phex protein: effect of the Hyp mutation and relationship to bone markers JOURNAL J Bone Miner Res 15 (8), 1440-1450 (2000) PUBMED 10934642 REFERENCE 6 (bases 1 to 1436) AUTHORS Haendler B, Habenicht UF, Schwidetzky U, Schuttke I and Schleuning WD. TITLE Differential androgen regulation of the murine genes for cysteine-rich secretory proteins (CRISP) JOURNAL Eur J Biochem 250 (2), 440-446 (1997) PUBMED 9428696 REFERENCE 7 (bases 1 to 1436) AUTHORS Schwidetzky U, Haendler B and Schleuning WD. TITLE Isolation and characterization of the androgen-dependent mouse cysteine-rich secretory protein-3 (CRISP-3) gene JOURNAL Biochem J 309 (Pt 3) (Pt 3), 831-836 (1995) PUBMED 7639699 REFERENCE 8 (bases 1 to 1436) AUTHORS Kasahara M, Hayashi M, Yoshida MC, Nadeau JH, Fujimoto S and Ishibashi T. TITLE Mapping of acidic epididymal glycoprotein (Aeg) genes to mouse chromosome 17 JOURNAL Mamm Genome 6 (1), 52-54 (1995) PUBMED 7719028 REFERENCE 9 (bases 1 to 1436) AUTHORS Haendler B, Kratzschmar J, Theuring F and Schleuning WD. TITLE Transcripts for cysteine-rich secretory protein-1 (CRISP-1; DE/AEG) and the novel related CRISP-3 are expressed under androgen control in the mouse salivary gland JOURNAL Endocrinology 133 (1), 192-198 (1993) PUBMED 8319566 REFERENCE 10 (bases 1 to 1436) AUTHORS Mizuki N and Kasahara M. TITLE Mouse submandibular glands express an androgen-regulated transcript encoding an acidic epididymal glycoprotein-like molecule JOURNAL Mol Cell Endocrinol 89 (1-2), 25-32 (1992) PUBMED 1301383 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CV307357.1 and L05560.1. On Mar 28, 2018 this sequence version replaced NM_009639.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L05560.1, BC022573.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN00849375, SAMN00849378 [ECO:0006172] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-30 CV307357.1 1-30 31-1436 L05560.1 1-1406 FEATURES Location/Qualifiers source 1..1436 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="17" /map="17 19.45 cM" gene 1..1436 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="cysteine-rich secretory protein 3" /db_xref="GeneID:11572" /db_xref="MGI:MGI:102552" exon 1..53 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 54..127 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" CDS 56..781 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="SCP 2; sperm-coating glycoprotein 2; acidic epididymal glycoprotein 2" /codon_start=1 /product="cysteine-rich secretory protein 3 precursor" /protein_id="NP_033769.1" /db_xref="CCDS:CCDS28783.1" /db_xref="GeneID:11572" /db_xref="MGI:MGI:102552" /translation="
MALMLVLFFLAAVLPPSLLQDNSQENSLEKLSTSKKSVQEEIVSKHNQLRRKVSPSGSDLLNMEWNYDAQVNAQQRADKCTFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWYNESKGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCRYCPVLNYSGHYPSRPYLAYTARAPCASCPDRCEDGLCTKSCQYKDMSFWCKRLEYVCKHPGLKKRCLATCQC"
sig_peptide 56..112 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="COORDINATES: ab initio prediction:SignalP:4.0" mat_peptide 113..778 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /product="Cysteine-rich secretory protein 3. /id=PRO_0000006269" /note="propagated from UniProtKB/Swiss-Prot (Q03402.1)" misc_feature 164..571 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="CAP (cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins) domain family; Region: CAP; cl00133" /db_xref="CDD:412178" misc_feature 407..409 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q03402.1); glycosylation site" misc_feature 449..451 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q03402.1); glycosylation site" misc_feature 578..580 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q03402.1); glycosylation site" misc_feature 635..778 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /note="Region: Crisp; pfam08562" /db_xref="CDD:430075" exon 128..244 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 245..332 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 333..478 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 479..573 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 574..674 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" exon 675..1417 /gene="Crisp3" /gene_synonym="Aeg2; CRISP-3; CRS3; SGP28" /inference="alignment:Splign:2.1.0" ORIGIN
gtcacctttcttcttcctgcaggacaacacctcattctactctgaagccagcaccatggcattaatgcttgtgctgttcttcctggctgctgtactgcccccatcccttcttcaagataactctcaggagaacagtcttgagaaactttcaaccagtaaaaaatcagtccaagaagagattgtaagcaagcacaaccaattgagacgaaaggtttctccatctggcagtgacttactaaatatggaatggaactatgatgctcaagtgaatgctcagcaacgggcagacaagtgtacattcagtcacagtcctatagaactcaggacaactaatttaaaatgtggtgagaatttgttcatgtcatcttaccttgtaccatggtcttctgtaatccaaggatggtataatgaatccaaaggtcttatatttggtgtgggcccaaagcaaaatgttagtgtggttggacatcatactcaggttgtttggaaatcaaatttacaagttgcatgtggagttgctgaatgccctgaaaatccactgagatacttttatgtttgtcgctattgtcctgtattgaattacagtggccattatccaagcaggccatacctagcttacacagcaagagcaccatgtgccagttgtcctgatcgctgtgaagatggactgtgcaccaagagttgtcaatataaggatatgtctttttggtgtaaacgtctggaatacgtctgtaaacatccaggtcttaaaaaacgttgcctagctacatgccaatgttaaggcaaaattcactaaatttcctgtccaggctgccaggaccaagtagagaaaggtcatactctctagtcaggcttatcacatcccaccaagaatatatagatttaatacattggaacaattccagatggtaaagattctgtttcttcttctatttctttctattttgcagatatcatttaccccaaatattttaaagtaacaaaattgataataacctttggaccttgacatttgaaatctgtgacacattcatgaagtcaaatctagccaatgactatacattgtctgtatgactaaagtcactaaaactcatatgactaatgttccaagagcacaatgaagtaagggaatagaaaacatatagttcctgtgtaatggtcagtcatcttttgtagctctacctagttaagtctctctgaagaaaattcacattgtctttttttttttctcactattcattattcttcacattcaacataatcagtggtttaaattctaaaataccatttacattttagttgtttttttttctaagaatgatataaaatgtaccttaatgagaagaatttgcttgttcaggggacaatgacctttgttgctttagaaaaaaaataaatcttaatcttggcttattaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]