ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-22 18:57:40, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_009082 688 bp mRNA linear ROD 01-MAY-2025
DEFINITION Mus musculus ribosomal protein L29 (Rpl29), transcript variant 2,
mRNA.
ACCESSION NM_009082
VERSION NM_009082.4
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 688)
AUTHORS Li,H., Huo,Y., He,X., Yao,L., Zhang,H., Cui,Y., Xiao,H., Xie,W.,
Zhang,D., Wang,Y., Zhang,S., Tu,H., Cheng,Y., Guo,Y., Cao,X.,
Zhu,Y., Jiang,T., Guo,X., Qin,Y. and Sha,J.
TITLE A male germ-cell-specific ribosome controls male fertility
JOURNAL Nature 612 (7941), 725-731 (2022)
PUBMED 36517592
REFERENCE 2 (bases 1 to 688)
AUTHORS Zhao,Q., Yan,S., Lu,J., Parker,D.J., Wu,H., Sun,Q., Crossman,D.K.,
Liu,S., Wang,Q., Sesaki,H., Mitra,K., Liu,K. and Jiao,K.
TITLE Drp1 regulates transcription of ribosomal protein genes in
embryonic hearts
JOURNAL J Cell Sci 135 (4) (2022)
PUBMED 35099001
REFERENCE 3 (bases 1 to 688)
AUTHORS Ali,M.I., Li,L., Li,L., Yao,L., Liu,J., Gu,W., Huang,S., Wang,B.
and Liu,G.
TITLE The tissue specific regulation of miR22 expression in the lung and
brain by ribosomal protein L29
JOURNAL Sci Rep 10 (1), 16242 (2020)
PUBMED 33004906
REMARK GeneRIF: The tissue specific regulation of miR22 expression in the
lung and brain by ribosomal protein L29.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 688)
AUTHORS Khatter,H., Myasnikov,A.G., Natchiar,S.K. and Klaholz,B.P.
TITLE Structure of the human 80S ribosome
JOURNAL Nature 520 (7549), 640-645 (2015)
PUBMED 25901680
REFERENCE 5 (bases 1 to 688)
AUTHORS Jones,D.T., Lechertier,T., Reynolds,L.E., Mitter,R., Robinson,S.D.,
Kirn-Safran,C.B. and Hodivala-Dilke,K.M.
TITLE Endogenous ribosomal protein L29 (RPL29): a newly identified
regulator of angiogenesis in mice
JOURNAL Dis Model Mech 6 (1), 115-124 (2013)
PUBMED 23118343
REMARK GeneRIF: depletion of Rpl29 using RNA interference inhibited
VEGF-induced aortic ring sprouting
REFERENCE 6 (bases 1 to 688)
AUTHORS Kirn-Safran,C.B., Julian,J., Fongemie,J.E., Hoke,D.E., Czymmek,K.J.
and Carson,D.D.
TITLE Changes in the cytologic distribution of heparin/heparan sulfate
interacting protein/ribosomal protein L29 (HIP/RPL29) during in
vivo and in vitro mouse mammary epithelial cell expression and
differentiation
JOURNAL Dev Dyn 223 (1), 70-84 (2002)
PUBMED 11803571
REMARK GeneRIF: analyzed the expression pattern in the mammary gland
especially with respect to luminal epithelial cell growth and
differentiation during pregnancy and lactation
REFERENCE 7 (bases 1 to 688)
AUTHORS Julian,J., Das,S.K., Dey,S.K., Baraniak,D., Ta,V.T. and Carson,D.D.
TITLE Expression of heparin/heparan sulfate interacting protein/ribosomal
protein l29 during the estrous cycle and early pregnancy in the
mouse
JOURNAL Biol Reprod 64 (4), 1165-1175 (2001)
PUBMED 11259264
REFERENCE 8 (bases 1 to 688)
AUTHORS Kirn-Safran,C.B., Dayal,S., Martin-DeLeon,P.A. and Carson,D.D.
TITLE Cloning, expression, and chromosome mapping of the murine Hip/Rpl29
gene
JOURNAL Genomics 68 (2), 210-219 (2000)
PUBMED 10964519
REFERENCE 9 (bases 1 to 688)
AUTHORS Hoke,D.E., Regisford,E.G., Julian,J., Amin,A., Begue-Kirn,C. and
Carson,D.D.
TITLE Murine HIP/L29 is a heparin-binding protein with a restricted
pattern of expression in adult tissues
JOURNAL J Biol Chem 273 (39), 25148-25157 (1998)
PUBMED 9737974
REFERENCE 10 (bases 1 to 688)
AUTHORS Rudert,F., Garnier,J.M. and Schuhbaur,B.
TITLE Cloning a pseudogene and cDNA encoding a 17-kDa ribosomal protein
from mouse: structure and regulation of expression
JOURNAL Gene 133 (2), 249-254 (1993)
PUBMED 8224911
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC151729.6.
On Dec 14, 2022 this sequence version replaced NM_009082.3.
Transcript Variant: This variant (2) contains an alternate segment
in the 5' UTR, compared to variant 1. Variants 1-3 encode the same
protein.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK013307.1, CK022864.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMN00849374, SAMN00849375
[ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-77 AC151729.6 134596-134672
78-122 AC151729.6 135003-135047
123-187 AC151729.6 135341-135405
188-688 AC151729.6 136102-136602
FEATURES Location/Qualifiers
source 1..688
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="9"
/map="9 57.49 cM"
gene 1..688
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="ribosomal protein L29"
/db_xref="GeneID:19944"
/db_xref="MGI:MGI:99687"
exon 1..77
/gene="Rpl29"
/gene_synonym="Rpl43"
/inference="alignment:Splign:2.1.0"
misc_feature 50..52
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="upstream in-frame stop codon"
exon 78..122
/gene="Rpl29"
/gene_synonym="Rpl43"
/inference="alignment:Splign:2.1.0"
CDS 86..568
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="60S ribosomal protein L29"
/codon_start=1
/product="large ribosomal subunit protein eL29"
/protein_id="NP_033108.1"
/db_xref="CCDS:CCDS23476.1"
/db_xref="GeneID:19944"
/db_xref="MGI:MGI:99687"
/translation="
MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKGLKKMQANNAKAVSARAEAIKALVKPQAIKPKMPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQTKAGAKAPAKAQASAPAQAPKGAQAPKGAQAPVKAP"
misc_feature 86..187
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="propagated from UniProtKB/Swiss-Prot (P47915.2);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 95..211
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="Ribosomal L29e protein family; Region:
Ribosomal_L29e; pfam01779"
/db_xref="CDD:460324"
misc_feature 98..100
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="N6-methyllysine.
/evidence=ECO:0000250|UniProtKB:P47914; propagated from
UniProtKB/Swiss-Prot (P47915.2); methylation site"
misc_feature 176..178
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P47914; propagated from
UniProtKB/Swiss-Prot (P47915.2); phosphorylation site"
misc_feature 182..184
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P47914; propagated from
UniProtKB/Swiss-Prot (P47915.2); acetylation site"
misc_feature 428..565
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="propagated from UniProtKB/Swiss-Prot (P47915.2);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 464..511
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="propagated from UniProtKB/Swiss-Prot (P47915.2);
Region: 2 X 8 AA tandem repeats of A-X-A-K-A-P-A-[KQ]"
misc_feature 497..499
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="Phosphoserine.
/evidence=ECO:0000250|UniProtKB:P47914; propagated from
UniProtKB/Swiss-Prot (P47915.2); phosphorylation site"
misc_feature 518..520
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="N6-acetyllysine.
/evidence=ECO:0007744|PubMed:23806337; propagated from
UniProtKB/Swiss-Prot (P47915.2); acetylation site"
exon 123..187
/gene="Rpl29"
/gene_synonym="Rpl43"
/inference="alignment:Splign:2.1.0"
exon 188..688
/gene="Rpl29"
/gene_synonym="Rpl43"
/inference="alignment:Splign:2.1.0"
regulatory 664..669
/regulatory_class="polyA_signal_sequence"
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="hexamer: AATAAA"
polyA_site 688
/gene="Rpl29"
/gene_synonym="Rpl43"
/note="major polyA site"
ORIGIN
agccgcgggttaccgtgagtgttggccttacggcatccgatgacatccgtgactacagggcggcggcgggtcgcgaggtgcagacatggccaagtccaagaaccacaccacacacaaccagtcccgcaaatggcacagaaatggcatcaagaaaccccggtcgcaaagatacgaatctcttaagggggttgaccccaagttcctgaggaacatgcgctttgccaagaagcacaacaagaaaggcctgaagaagatgcaggccaacaatgcaaaggcagtgagtgcgcgcgcagaggccatcaaggccctggtgaagcctcaggccatcaagcccaagatgccaaaaggccccaaactcaagcggctggctttcatcgctcaccccaagcttgggaagcggattcgaagctacatggccaagggtcagaggctctgccaaccgaagcctaaggtccaaaccaaggcaggggccaaagctccagctaaggcccaggcttcagctccagctcaggctcccaaaggtgctcaggcccccaaaggtgcccaggcccctgtgaaggccccatagaaaaggctcctgccagtgtgaagacagacggactgctgtgacacacctccccacacactatttgcagatgaccagtgtcctatgctgttcttacaaataaactcaggcaagatctgttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]