LOCUS       NM_008955                882 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 6 (Rhox6), mRNA.
ACCESSION   NM_008955
VERSION     NM_008955.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 882)
  AUTHORS   Nowotschin S, Setty M, Kuo YY, Liu V, Garg V, Sharma R, Simon CS,
            Saiz N, Gardner R, Boutet SC, Church DM, Hoodless PA, Hadjantonakis
            AK and Pe'er D.
  TITLE     The emergent landscape of the mouse gut endoderm at single-cell
            resolution
  JOURNAL   Nature 569 (7756), 361-367 (2019)
   PUBMED   30959515
REFERENCE   2  (bases 1 to 882)
  AUTHORS   Thompson CL, Ng L, Menon V, Martinez S, Lee CK, Glattfelder K,
            Sunkin SM, Henry A, Lau C, Dang C, Garcia-Lopez R, Martinez-Ferre
            A, Pombero A, Rubenstein JLR, Wakeman WB, Hohmann J, Dee N, Sodt
            AJ, Young R, Smith K, Nguyen TN, Kidney J, Kuan L, Jeromin A,
            Kaykas A, Miller J, Page D, Orta G, Bernard A, Riley Z, Smith S,
            Wohnoutka P, Hawrylycz MJ, Puelles L and Jones AR.
  TITLE     A high-resolution spatiotemporal atlas of gene expression of the
            developing mouse brain
  JOURNAL   Neuron 83 (2), 309-323 (2014)
   PUBMED   24952961
REFERENCE   3  (bases 1 to 882)
  AUTHORS   Wang Q, Liu X, Tang N, Archambeault DR, Li J, Song H, Tang C, He B,
            Matzuk MM and Wang Y.
  TITLE     GASZ promotes germ cell derivation from embryonic stem cells
  JOURNAL   Stem Cell Res 11 (2), 845-860 (2013)
   PUBMED   23816659
REFERENCE   4  (bases 1 to 882)
  AUTHORS   Oda M, Oxley D, Dean W and Reik W.
  TITLE     Regulation of lineage specific DNA hypomethylation in mouse
            trophectoderm
  JOURNAL   PLoS One 8 (6), e68846 (2013)
   PUBMED   23825703
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 882)
  AUTHORS   Berletch JB, Deng X, Nguyen DK and Disteche CM.
  TITLE     Female bias in Rhox6 and 9 regulation by the histone demethylase
            KDM6A
  JOURNAL   PLoS Genet 9 (5), e1003489 (2013)
   PUBMED   23658530
  REMARK    GeneRIF: We report that two members of the Rhox cluster, Rhox6 and
            9, are regulated by de-methylation of histone H3 at lysine 27 by
            KDM6A
REFERENCE   6  (bases 1 to 882)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
REFERENCE   7  (bases 1 to 882)
  AUTHORS   Small CL, Shima JE, Uzumcu M, Skinner MK and Griswold MD.
  TITLE     Profiling gene expression during the differentiation and
            development of the murine embryonic gonad
  JOURNAL   Biol Reprod 72 (2), 492-501 (2005)
   PUBMED   15496517
REFERENCE   8  (bases 1 to 882)
  AUTHORS   Takasaki N, McIsaac R and Dean J.
  TITLE     Gpbox (Psx2), a homeobox gene preferentially expressed in female
            germ cells at the onset of sexual dimorphism in mice
  JOURNAL   Dev Biol 223 (1), 181-193 (2000)
   PUBMED   10864470
REFERENCE   9  (bases 1 to 882)
  AUTHORS   Chun JY, Han YJ and Ahn KY.
  TITLE     Psx homeobox gene is X-linked and specifically expressed in
            trophoblast cells of mouse placenta
  JOURNAL   Dev Dyn 216 (3), 257-266 (1999)
   PUBMED   10590477
REFERENCE   10 (bases 1 to 882)
  AUTHORS   Han YJ, Park AR, Sung DY and Chun JY.
  TITLE     Psx, a novel murine homeobox gene expressed in placenta
  JOURNAL   Gene 207 (2), 159-166 (1998)
   PUBMED   9511757
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AF017453.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF017453.1, DQ058643.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849385, SAMN01164131
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..882
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 22.08 cM"
     gene            1..882
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /note="reproductive homeobox 6"
                     /db_xref="GeneID:19202"
                     /db_xref="MGI:MGI:1202888"
     exon            1..125
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /inference="alignment:Splign:2.1.0"
     CDS             44..727
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /note="placenta specific homeobox 1"
                     /codon_start=1
                     /product="reproductive homeobox on X chromosome, 6"
                     /protein_id="NP_032981.1"
                     /db_xref="CCDS:CCDS30080.1"
                     /db_xref="GeneID:19202"
                     /db_xref="MGI:MGI:1202888"
                     /translation="

METPQDSRQSIQKPPSPAAEEDKEEQPGGNAVVSGAPEERIDKKELVLNWLAQGEFDQGEGAQGEVAGGEQAQEEPAPLSPAQEATGGEEEGENKEGEMEGRHAGDGASSSEDDSILEEGGENIDQQPPQQEAASPDSIRNPHVLNRLAQLRYRRTRFTHSQLHDLERLFQETRYPSLRARRDLARWMGVDECDVQNWFRMRRALFQRNRRVLMFCELPPLPQSDSP"

     misc_feature    order(497..511,515..517,566..568,584..586,623..625,
                     629..634,641..646,650..655)
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    503..655
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(503..505,512..514,632..634,641..646,653..655)
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            126..585
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /inference="alignment:Splign:2.1.0"
     exon            586..631
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /inference="alignment:Splign:2.1.0"
     exon            632..865
                     /gene="Rhox6"
                     /gene_synonym="Psx1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggaagcctcttcgggagcagcgtcggatccagagattctcgctatggaaactcctcaagacagccgccaaagcatccaaaagcctccgagtccggcagccgaggaggacaaggaagaacagcctggtgggaatgcagtggtctccggggctccagaggaaagaatagacaagaaagagcttgtactgaactggctcgctcagggtgagtttgatcagggcgaaggcgctcagggcgaggttgctggaggtgagcaggctcaagaagagcctgctccattgagtccagctcaggaagccactggaggagaagaggagggagaaaacaaggaaggagaaatggaaggaagacatgctggtgatggtgcttctagctccgaggatgacagcatcctggaagaaggcggcgaaaacatagatcaacagccgcctcagcaagaggcagccagtcctgatagcatcagaaacccacatgttctgaataggctggctcaactgcggtacagacgcaccaggttcacccactctcagctgcatgacctggagcgccttttccaagagactcgctaccccagcttgcgagcaaggagggatcttgcacgatggatgggtgtggatgaatgtgatgtgcagaattggtttcggatgaggagagcccttttccagagaaacaggagagtgctgatgttctgcgaactgccgcctcttccccagagcgactctccctgaagattttggagcagcacttgagtgccagccctgtcatggagccagatgaggatggcttcttctgagccacccatgatggccatgacaaccttttcttctctacaattatttcagcaataaagatgagcattctgaataaaaaaaaaaaaaaaaaa

//