LOCUS       NM_008178               1783 bp    mRNA    linear   ROD 04-OCT-2023
DEFINITION  Mus musculus GS homeobox 1 (Gsx1), mRNA.
ACCESSION   NM_008178
VERSION     NM_008178.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1783)
  AUTHORS   Talley MJ, Nardini D, Ehrman LA, Lu QR and Waclaw RR.
  TITLE     Distinct requirements for Tcf3 and Tcf12 during oligodendrocyte
            development in the mouse telencephalon
  JOURNAL   Neural Dev 18 (1), 5 (2023)
   PUBMED   37684687
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1783)
  AUTHORS   Manuel M, Tan KB, Kozic Z, Molinek M, Marcos TS, Razak MFA, Dobolyi
            D, Dobie R, Henderson BEP, Henderson NC, Chan WK, Daw MI, Mason JO
            and Price DJ.
  TITLE     Pax6 limits the competence of developing cerebral cortical cells to
            respond to inductive intercellular signals
  JOURNAL   PLoS Biol 20 (9), e3001563 (2022)
   PUBMED   36067211
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1783)
  AUTHORS   Su-Feher L, Rubin AN, Silberberg SN, Catta-Preta R, Lim KJ,
            Ypsilanti AR, Zdilar I, McGinnis CS, McKinsey GL, Rubino TE Jr,
            Hawrylycz MJ, Thompson C, Gartner ZJ, Puelles L, Zeng H, Rubenstein
            JLR and Nord AS.
  TITLE     Single cell enhancer activity distinguishes GABAergic and
            cholinergic lineages in embryonic mouse basal ganglia
  JOURNAL   Proc Natl Acad Sci U S A 119 (15), e2108760119 (2022)
   PUBMED   35377797
REFERENCE   4  (bases 1 to 1783)
  AUTHORS   Zhang K, Yu F, Zhu J, Han S, Chen J, Wu X, Chen Y, Shen T, Liao J,
            Guo W, Yang X, Wang R, Qian Y, Yang J, Cheng L, Zhao Y, Hui CC, Li
            J, Peng G, He S, Jing N and Tang K.
  TITLE     Imbalance of Excitatory/Inhibitory Neuron Differentiation in
            Neurodevelopmental Disorders with an NR2F1 Point Mutation
  JOURNAL   Cell Rep 31 (3), 107521 (2020)
   PUBMED   32320667
REFERENCE   5  (bases 1 to 1783)
  AUTHORS   Ma TC, Vong KI and Kwan KM.
  TITLE     Spatiotemporal Decline of BMP Signaling Activity in Neural
            Progenitors Mediates Fate Transition and Safeguards Neurogenesis
  JOURNAL   Cell Rep 30 (11), 3616-3624 (2020)
   PUBMED   32187534
REFERENCE   6  (bases 1 to 1783)
  AUTHORS   Mastick GS, Davis NM, Andrew GL and Easter SS Jr.
  TITLE     Pax-6 functions in boundary formation and axon guidance in the
            embryonic mouse forebrain
  JOURNAL   Development 124 (10), 1985-1997 (1997)
   PUBMED   9169845
REFERENCE   7  (bases 1 to 1783)
  AUTHORS   Li H, Zeitler PS, Valerius MT, Small K and Potter SS.
  TITLE     Gsh-1, an orphan Hox gene, is required for normal pituitary
            development
  JOURNAL   EMBO J 15 (4), 714-724 (1996)
   PUBMED   8631293
REFERENCE   8  (bases 1 to 1783)
  AUTHORS   Sommers CL, Huang K, Shores EW, Grinberg A, Charlick DA, Kozak CA
            and Love PE.
  TITLE     Murine txk: a protein tyrosine kinase gene regulated by T cell
            activation
  JOURNAL   Oncogene 11 (2), 245-251 (1995)
   PUBMED   7542761
REFERENCE   9  (bases 1 to 1783)
  AUTHORS   Valerius MT, Li H, Stock JL, Weinstein M, Kaur S, Singh G and
            Potter SS.
  TITLE     Gsh-1: a novel murine homeobox gene expressed in the central
            nervous system
  JOURNAL   Dev Dyn 203 (3), 337-351 (1995)
   PUBMED   8589431
REFERENCE   10 (bases 1 to 1783)
  AUTHORS   Singh G, Kaur S, Stock JL, Jenkins NA, Gilbert DJ, Copeland NG and
            Potter SS.
  TITLE     Identification of 10 murine homeobox genes
  JOURNAL   Proc Natl Acad Sci U S A 88 (23), 10706-10710 (1991)
   PUBMED   1683707
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC115847.19.
            
            On Oct 27, 2022 this sequence version replaced NM_008178.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: U21224.1, BC137769.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164132
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-617               AC115847.19        105556-106172
            618-1783            AC115847.19        106652-107817
FEATURES             Location/Qualifiers
     source          1..1783
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="5"
                     /map="5 86.79 cM"
     gene            1..1783
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="GS homeobox 1"
                     /db_xref="GeneID:14842"
                     /db_xref="MGI:MGI:95842"
     exon            1..617
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /inference="alignment:Splign:2.1.0"
     CDS             209..994
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="homeobox protein GSH-1; genomic screened homeo box
                     1"
                     /codon_start=1
                     /product="GS homeobox 1"
                     /protein_id="NP_032204.1"
                     /db_xref="CCDS:CCDS19877.1"
                     /db_xref="GeneID:14842"
                     /db_xref="MGI:MGI:95842"
                     /translation="

MPRSFLVDSLVLREASDKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGAGAGAGGGAPQGCKCSSLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP"

     misc_feature    209..268
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="propagated from UniProtKB/Swiss-Prot (P31315.2);
                     Region: SNAG domain. /evidence=ECO:0000250"
     misc_feature    order(647..661,665..667,716..718,734..736,773..775,
                     779..784,791..796,800..808,812..817)
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(653..655,662..664,782..784,791..796,803..805)
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    656..814
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    809..991
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /note="propagated from UniProtKB/Swiss-Prot (P31315.2);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            618..1783
                     /gene="Gsx1"
                     /gene_synonym="Gsh-1; Gsh1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

accactagcgctggccagcacctcgcccgctccgggaggtgcccgcagcagcagccaaggtgattccagcccgggcttgagccgcgcgtggagcctccggggcccgggaagctgcgggtggccgcggccaggggaagctacgacaggatctgcagttccctcgggctccaggggcgggctggcggcaggtggaccgcgcgccggagccatgccgcgctccttcctggtggattcccttgtgctgcgggaagccagcgacaagaaggctccggagggcagcccgccaccgctcttcccctacgcggtcccgccgccgcacgcgctccacggcctctcgccgggcgcctgccacgcgcgcaaggccggcttgctgtgcgtgtgtcccctctgtgtcaccgcttcgcagctgcacgggccccccgggccgccggcactgccgctactcaaggcgtccttccctcccttcggatcgcagtactgccacgcacccctgggccgccagcactccgtgtcccctggagtcgcccacggcccggctgcggccgcagcagctgctgcactctaccagacctcctacccgctgccggatcccagacagtttcactgcatctctgtggacagcagctcgaaccagctgcccagcagcaagaggatgcggacggcgttcaccagcacacagctcctggagctggagcgagagttcgcctccaacatgtacctctcccgcctgcggcgcatcgagatcgcgacctatctgaacctgtccgagaagcaggtgaagatctggtttcagaaccgccgggtgaagcacaagaaagaaggcaaaggcagtaaccaccgcggcggagctggggcgggggccggcgggggcgcaccgcaaggctgcaagtgctcttcgctctcctcagccaaatgctcagaggacgacgacgaattgcccatgtctccatcttcctccgggaaggatgacagagatctcacagtcactccgtaggtgcgccttttagaggaccattggtttccccaccccccaccccgacccttcccgcactggtccccaggcacccgctggccaaccgacggatttcgttgggctttgcggtggtgcgcagctttaggcagagctaagaccttagcagacacttgaagacagtgcccctgtcccttgggcttcagggtgtttaggaggactccaagcgatgaaggctgagtcctcctcctaggacacagcctcttctcccaggcacgcaggccggagcacagcgccttgctgaccgccagcgcctcttcgcctgccaactctgggctggttcaagcttcctcggttccactattctctccttctcggtcaatctgggcttttcactccgcgagtggctgtttgcttttcttttaacatttctttcttgcccccaactcgtctccccccactgtggtcctttatgcaacacgtctatggacttaacttttccttccctcctcaggaagtctctcccttctgtccgtttgtcccttaaacagggatcaggtcttgctgttcgaagaagtccccctagcagagagaactgtctcacatggtattgtattggggaaaatgactctgtttccaatacgctctaaacccccttcaaatgaagccgctgtaaccaacctctccccattgtccaggccccgactccctctggggactgactgactgtgtcattgtatcgtctctgtaatgccagaagatatttatttatttatttatgtacaaaattttaaataaactttttttttctta

//