LOCUS       NM_007966               2877 bp    mRNA    linear   ROD 04-MAR-2025
DEFINITION  Mus musculus even-skipped homeobox 1 (Evx1), mRNA.
ACCESSION   NM_007966
VERSION     NM_007966.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 2877)
  AUTHORS   Vermeiren,S., Cabochette,P., Dannawi,M., Desiderio,S., San
            Jose,A.S., Achouri,Y., Kricha,S., Sitte,M., Salinas-Riester,G.,
            Vanhollebeke,B., Brunet,J.F. and Bellefroid,E.J.
  TITLE     Prdm12 represses the expression of the visceral neuron determinants
            Phox2a/b in developing somatosensory ganglia
  JOURNAL   iScience 26 (12), 108364 (2023)
   PUBMED   38025786
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2877)
  AUTHORS   Sartoretti,M.M., Campetella,C.A. and Lanuza,G.M.
  TITLE     Dbx1 controls the development of astrocytes of the intermediate
            spinal cord by modulating Notch signaling
  JOURNAL   Development 149 (15) (2022)
   PUBMED   35815610
REFERENCE   3  (bases 1 to 2877)
  AUTHORS   Wang,Y.B., Song,N.N., Zhang,L., Ma,P., Chen,J.Y., Huang,Y., Hu,L.,
            Mao,B. and Ding,Y.Q.
  TITLE     Rnf220 is Implicated in the Dorsoventral Patterning of the
            Hindbrain Neural Tube in Mice
  JOURNAL   Front Cell Dev Biol 10, 831365 (2022)
   PUBMED   35399523
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2877)
  AUTHORS   Bernhardt,N., Memic,F., Velica,A., Tran,M.A., Vieillard,J.,
            Sayyab,S., Chersa,T., Andersson,L., Whelan,P.J., Boije,H. and
            Kullander,K.
  TITLE     Hop Mice Display Synchronous Hindlimb Locomotion and a Ventrally
            Fused Lumbar Spinal Cord Caused by a Point Mutation in Ttc26
  JOURNAL   eNeuro 9 (2) (2022)
   PUBMED   35210288
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2877)
  AUTHORS   Schnerwitzki,D., Hayn,C., Perner,B. and Englert,C.
  TITLE     Wt1 Positive dB4 Neurons in the Hindbrain Are Crucial for
            Respiration
  JOURNAL   Front Neurosci 14, 529487 (2020)
   PUBMED   33328840
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2877)
  AUTHORS   Niswander,L. and Martin,G.R.
  TITLE     FGF-4 regulates expression of Evx-1 in the developing mouse limb
  JOURNAL   Development 119 (1), 287-294 (1993)
   PUBMED   7506139
REFERENCE   7  (bases 1 to 2877)
  AUTHORS   Dush,M.K. and Martin,G.R.
  TITLE     Analysis of mouse Evx genes: Evx-1 displays graded expression in
            the primitive streak
  JOURNAL   Dev Biol 151 (1), 273-287 (1992)
   PUBMED   1349539
REFERENCE   8  (bases 1 to 2877)
  AUTHORS   Jones,F.S., Chalepakis,G., Gruss,P. and Edelman,G.M.
  TITLE     Activation of the cytotactin promoter by the homeobox-containing
            gene Evx-1
  JOURNAL   Proc Natl Acad Sci U S A 89 (6), 2091-2095 (1992)
   PUBMED   1372434
REFERENCE   9  (bases 1 to 2877)
  AUTHORS   Faiella,A., D'Esposito,M., Rambaldi,M., Acampora,D., Balsofiore,S.,
            Stornaiuolo,A., Mallamaci,A., Migliaccio,E., Gulisano,M. and
            Simeone,A.
  TITLE     Isolation and mapping of EVX1, a human homeobox gene homologous to
            even-skipped, localized at the 5' end of HOX1 locus on chromosome 7
  JOURNAL   Nucleic Acids Res 19 (23), 6541-6545 (1991)
   PUBMED   1684419
REFERENCE   10 (bases 1 to 2877)
  AUTHORS   Bastian,H. and Gruss,P.
  TITLE     A murine even-skipped homologue, Evx 1, is expressed during early
            embryogenesis and neurogenesis in a biphasic manner
  JOURNAL   EMBO J 9 (6), 1839-1852 (1990)
   PUBMED   1971786
  REMARK    Erratum:[EMBO J 1991 Dec;10(12):3978]
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC113985.11.
            
            On Oct 19, 2007 this sequence version replaced NM_007966.3.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X54239.1, SRR7345562.5148373.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849381
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-774               AC113985.11        108214-108987
            775-1031            AC113985.11        110454-110710
            1032-2877           AC113985.11        111249-113094
FEATURES             Location/Qualifiers
     source          1..2877
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 25.44 cM"
     gene            1..2877
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="even-skipped homeobox 1"
                     /db_xref="GeneID:14028"
                     /db_xref="MGI:MGI:95461"
     exon            1..774
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    297..299
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="upstream in-frame stop codon"
     CDS             348..1598
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="even skipped homeotic gene 1 homolog"
                     /codon_start=1
                     /product="homeobox even-skipped homolog protein 1"
                     /protein_id="NP_031992.1"
                     /db_xref="CCDS:CCDS20149.1"
                     /db_xref="GeneID:14028"
                     /db_xref="MGI:MGI:95461"
                     /translation="

MESRKDMVMFLDGGQLGTLVGKRVSNLSEAVSSPLPEPPEKMVPHGCLSPRAGPPTSRERGGGGQEEEPVDGLAGSAAGLGAEPRSAGAAMLGPGPPVPSADSLSGQGQPSSSDTESDFYEEIEVSCTPDCATGNAEYQHSKAPGSDALGSSPTSGSEAPKSNGGSGGSGSQGTLACSASDQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKRQRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPFSGPLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAAAAAAAGPCSCLACHSGPANGLAPRAAAAAAASDFTCASTSRSDSFLTFAPSVLSKASSVAALDQREEVPLTR"

     misc_feature    435..707
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="propagated from UniProtKB/Swiss-Prot (P23683.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    759..881
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="propagated from UniProtKB/Swiss-Prot (P23683.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    897..1067
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            775..1031
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /inference="alignment:Splign:2.1.0"
     exon            1032..2877
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      2846..2851
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="hexamer: AATAAA"
     polyA_site      2874
                     /gene="Evx1"
                     /gene_synonym="Evx-1"
                     /note="major polyA site"
ORIGIN      

ctcctttcatcttcactgtggcagacgtttctatttatccacttgcgttcgccgagtggcgtcaccagcggtactgtaatgacgattgcagcaggaggatgacagcttagaaagaagagggcaatggggcttcctcccagaggcggtgcggcacagaggagcgctcgcatcacaaggtgaccctagctccccactgccatctccgcggtcgccgtcgacacggcgctggggctacccggcgcctgccttgtcgccttagctcctcttctcagccaagatcccagggagcctgggattaggagcttacttgggggttttccccctccccccctctggagagtccggggatggagagccgaaaggacatggttatgtttctggatgggggtcagcttggcactctggttggtaagagggtctctaatttgtccgaagccgtgagcagcccgctgcctgaaccgccagagaagatggtgccccacggttgcctgagcccgcgagccggccctccgacttcccgggagcgtggcgggggaggccaggaggaggagccggtcgatggactagcaggcagtgctgcagggctgggcgccgagccacggtctgctggagcggccatgcttggcccgggacccccagtcccctccgcggacagcctctctggccaagggcaacctagtagctcagacaccgaatcggatttctatgaagaaatcgaggtgagctgcaccccagactgcgccaccgggaacgccgagtaccagcacagcaaagcgccaggctccgatgctctgggtagcagtcctaccagtggcagcgaggcccccaagagtaacggtggcagcggcggcagcggctctcaaggcaccctggcctgcagcgccagtgaccagatgcgccgataccgcacggcctttacccgggagcagattgcaaggctggagaaagagttctacagggagaactacgtttcaagaccgcggagatgcgaactggcagcagccttaaaccttcctgaaactaccatcaaggtgtggtttcagaaccggcgcatgaaggacaagcgtcagcggctggccatgacgtggccgcacccggccgaccctgccttctacacctacatgatgagccacgcggcggccgcgggcggcctgccctaccccttcccgtcgcacctgcccctgccctactactcgcccgtgggcctgggcgccgcgtccgccgcctcggccgccgcctcgcccttcagcggccccctgcgcccgctcgacaccttccgcgtgctctcgcagccctacccacggcccgaactgctgtgcgccttccgccacccgccgctctatcccggcccggcgcacggactcggcgcctcggccgccgccgccgctgccgccgggccctgctcctgcctcgcctgccacagcggcccggccaacgggctggcgcccagggccgccgccgctgccgccgcctcagacttcacttgtgcctccacctcccgctcggactccttcctcacgttcgccccctctgtgctcagcaaggcctcctccgtggcggcgttggaccagagagaggaggtgcccctcaccagataagggggcgccctcggggctgccgactgcaggatggacgtcgtggggtggaggtcgggggagccttcggggctcctccagcatcccacctgtcacctctcttctcagatgcacaggggaaaggaggtggaggtggggggggggacaccataaaggactccgcctagaggatccaggagccccagaagcgacattggctgcttaggagcaggaatggggtgggaaagcgtcccctggggtggccaggccttgccattctccaccgaaaccaccactctatcagaggtcgaggccttggttcaacagctacccgggaacaacccactcccaagcccctcgtacccttcaactgggcccccactctcctgtcaagggcaagagctgcgaagggaactcgctgtttcttggaacaaaatgctgtgtatgcagagcaggtagaaattaatcttcaccagcttttccaacgcatggcagggggcttgttgatggcaacatcccagccatttaggggagagatgatttactgctagggagatgcttgccacttggcgaggaacctgggagccggctcaccttcccagggcctcaactacacagcatctggggagtggtaccctctaccagccactgacttctttccctatttctggctttgtgacatctcacgacccgacctgtgcagctccagccttctcccttccggtttgacattggcagggaaggggcaggggctccagggtccctaggcagcttctgtggggcgaacctcttctcccttaacccagcacacagcctgattagcaagtgatgggtgaggaggggtttttgaatgttgaatgtatgtataataatgatcaccactctgctgggccaccaagcccggagctgctgagccggtctaacaaggcgccctgggaagagcttagggaacggagacttcttacattcttctctcattgtctccccaaattgccacagggccttggctttcagctgccagtacaaaccttcagcgcctctggaggaccctgtctctccccttcactggggtttattggggagccacttaggaactcctgtactcatccttatagccagtgtttgaggaaaaggacaacttcaatcatccaatgcaggcttccctccactgggaggaagtggtccttcctgcagggaatgaatttggtttggtttggggttttcctttgcagcccaaagaatttgctgttatgatttgttaaccatattgcaataaaagctgaacatgattcttactttagca

//