2024-05-04 09:03:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_007867 1820 bp mRNA linear ROD 29-AUG-2023 DEFINITION Mus musculus distal-less homeobox 4 (Dlx4), mRNA. ACCESSION NM_007867 VERSION NM_007867.4 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1820) AUTHORS Qu F, Li W, Xu J, Zhang R, Ke J, Ren X, Meng X, Qin L, Zhang J, Lu F, Zhou X, Luo X, Zhang Z, Wang M, Wu G, Pei D, Chen J, Cui G, Suo S and Peng G. TITLE Three-dimensional molecular architecture of mouse organogenesis JOURNAL Nat Commun 14 (1), 4599 (2023) PUBMED 37524711 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1820) AUTHORS Vanyai HK, Garnham A, May RE, McRae HM, Collin C, Wilcox S, Smyth GK, Thomas T and Voss AK. TITLE MOZ directs the distal-less homeobox gene expression program during craniofacial development JOURNAL Development 146 (14) (2019) PUBMED 31340933 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1820) AUTHORS Johnson JA, Watson JK, Nikolic MZ and Rawlins EL. TITLE Fank1 and Jazf1 promote multiciliated cell differentiation in the mouse airway epithelium JOURNAL Biol Open 7 (4) (2018) PUBMED 29661797 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1820) AUTHORS Van Otterloo E, Li H, Jones KL and Williams T. TITLE AP-2alpha and AP-2beta cooperatively orchestrate homeobox gene expression during branchial arch patterning JOURNAL Development 145 (2) (2018) PUBMED 29229773 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 1820) AUTHORS Inoue K, Hirose M, Inoue H, Hatanaka Y, Honda A, Hasegawa A, Mochida K and Ogura A. TITLE The Rodent-Specific MicroRNA Cluster within the Sfmbt2 Gene Is Imprinted and Essential for Placental Development JOURNAL Cell Rep 19 (5), 949-956 (2017) PUBMED 28467908 REFERENCE 6 (bases 1 to 1820) AUTHORS Toresson H, Mata de Urquiza A, Fagerstrom C, Perlmann T and Campbell K. TITLE Retinoids are produced by glia in the lateral ganglionic eminence and regulate striatal neuron differentiation JOURNAL Development 126 (6), 1317-1326 (1999) PUBMED 10021349 REFERENCE 7 (bases 1 to 1820) AUTHORS Quinn LM, Johnson BV, Nicholl J, Sutherland GR and Kalionis B. TITLE Isolation and identification of homeobox genes from the human placenta including a novel member of the Distal-less family, DLX4 JOURNAL Gene 187 (1), 55-61 (1997) PUBMED 9073066 REFERENCE 8 (bases 1 to 1820) AUTHORS Nakamura S, Stock DW, Wydner KL, Bollekens JA, Takeshita K, Nagai BM, Chiba S, Kitamura T, Freeland TM, Zhao Z, Minowada J, Lawrence JB, Weiss KM and Ruddle FH. TITLE Genomic analysis of a new mammalian distal-less gene: Dlx7 JOURNAL Genomics 38 (3), 314-324 (1996) PUBMED 8975708 REFERENCE 9 (bases 1 to 1820) AUTHORS Weiss KM, Ruddle FH and Bollekens J. TITLE Dlx and other homeobox genes in the morphological development of the dentition JOURNAL Connect Tissue Res 32 (1-4), 35-40 (1995) PUBMED 7554933 REFERENCE 10 (bases 1 to 1820) AUTHORS Robinson GW, Wray S and Mahon KA. TITLE Spatially restricted expression of a member of a new family of murine Distal-less homeobox genes in the developing forebrain JOURNAL New Biol 3 (12), 1183-1194 (1991) PUBMED 1687503 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL645850.6. On Apr 8, 2008 this sequence version replaced NM_007867.3. Sequence Note: This RefSeq record was created from genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments and orthologous data. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AK145123.1, U73329.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375, SAMN00849384 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-606 AL645850.6 14840-15445 c 607-797 AL645850.6 11433-11623 c 798-1820 AL645850.6 10091-11113 c FEATURES Location/Qualifiers source 1..1820 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="11" /map="11 59.01 cM" gene 1..1820 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="distal-less homeobox 4" /db_xref="GeneID:13394" /db_xref="MGI:MGI:94904" exon 1..606 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /inference="alignment:Splign:2.1.0" misc_feature 288..290 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="upstream in-frame stop codon" CDS 321..1043 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="homeobox protein DLX-7; distal-less homeo box 7; DII D" /codon_start=1 /product="homeobox protein DLX-4" /protein_id="NP_031893.3" /db_xref="CCDS:CCDS25273.1" /db_xref="GeneID:13394" /db_xref="MGI:MGI:94904" /translation="
MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDLSYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSLVPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIWFQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHFGAWYQHRSPDVLALPQMM"
misc_feature 450..530 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="propagated from UniProtKB/Swiss-Prot (P70436.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(669..683,687..689,738..740,756..758,795..797, 801..806,813..818,822..830,834..839) /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 675..836 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(675..677,684..686,804..806,813..818,825..827) /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 843..902 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /note="propagated from UniProtKB/Swiss-Prot (P70436.2); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 607..797 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /inference="alignment:Splign:2.1.0" exon 798..1820 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" /inference="alignment:Splign:2.1.0" regulatory 1791..1796 /regulatory_class="polyA_signal_sequence" /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" polyA_site 1820 /gene="Dlx4" /gene_synonym="Dlx-4; Dlx7" ORIGIN
aacacgaggggtggggggcgggctcagcttgaggtcaccaaggaatagccaatccggggtgtctaagtgggcgggggacccctggggtcccgggaaccgaacccagaggaaaagatggggaagggtaaaaccacggggtaccccaaaaaaccctttcccgggtgcgagttctctgccggaagaggctcagagagacatttttccaggcatctgaagtgtaagagtggcttgctggagctggagactttgaaaggagctggcagaaagagtagacagcgtgcgggccatgacctaggccctgtggcccggcaccggccgcaatgacctctttaccctgtccccttcctgaccgtggtgcctccaacgttgtcttcccggacctcgcccccgccctgtcggtagtggctgcttacccgctcggactatccccgggaaccgcagcttctcccgatttgtcctactcccagtcctacggccacccccggtcctattcccaccctgggccggcaaccccaggagactcctacctgccccgccagcaacaattggtggcgccatctcagccctttcacaggccggctgaacacccgcaggagctcgaagcagaatcagagaagctggcactgtctctggtgccctcccagcagcagtccctgaccaggaagctgcgcaagcccagaaccatctactctagcctgcagctccaacacctgaaccagcgtttccagcacacccaatacctggccctgcccgagagagctcagctggcagcacaactcggactcacccaaacccaggtaaagatctggtttcagaacaaacgctccaaatataagaagctcctgaaacagagctctggggagccggaagaggacttctctgggagacccccctccctgtctccccactctccagccctaccattcatctggggtctacccaaggcagacaccctgccttccagtggctatgacaacagccactttggtgcctggtatcagcatcgctccccagatgtgctggcactgcctcagatgatgtgagtctggagggaggctggtcagacttcagccctcctgtcaagcccaggacccgagcacctgctccccttctgggaggagaggaaaccagctccagatggattttctcagaagacaagacaccgaaggagaaaaagggaaagaatggtgtggaagcctggctctccaaagcagagagttagatcaggggctttggacggccacaatcttgccactccctctccttcaaatgactgcagccccaagcacagccctaggatccaaaccaggaagaaaacaaatattattcctggcctgcaccatgggggcccagacagcccttccaggaacaaaaccagaagtggacacagggtctgtgttgttggccaccatagagtctccgactttcatttactaattactggtggtggcccagtggtagagtgagtgtttaacatgtaaaaggccccagctccaaagcaaaacttgtggacctgtgggcagcttgtgcttctccgctttaaacggctctctagcgccatatctacccattttgaattgatagccatgggcttaatcgtccatataattcaacagtatgtattaagagcctaggcccacgactctccatccttaacacctaacaagttcacctgcacacattgttggaagcccagaaggagaaatgggacaaacagattaccaggatcagtgcaggcatagctcctcgctgttgcctcgatcaaagaaactgctctcaaatcacaagctattaaaatgtatatatgtattaaaaaagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]