GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-05 20:29:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001420745             773 bp    mRNA    linear   ROD 12-DEC-2023
DEFINITION  Mus musculus prostaglandin D2 synthase (brain) (Ptgds), transcript
            variant 3, mRNA.
ACCESSION   NM_001420745
VERSION     NM_001420745.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 773)
  AUTHORS   Oh Y, Kasu M, Bottoms CJ, Douglas JC, Sekulovski N, Hayashi K and
            MacLean Ii JA.
  TITLE     Rhox8 homeobox gene ablation leads to rete testis abnormality and
            male subfertility in micedagger
  JOURNAL   Biol Reprod 109 (4), 520-532 (2023)
   PUBMED   37471646
REFERENCE   2  (bases 1 to 773)
  AUTHORS   Qu F, Li W, Xu J, Zhang R, Ke J, Ren X, Meng X, Qin L, Zhang J, Lu
            F, Zhou X, Luo X, Zhang Z, Wang M, Wu G, Pei D, Chen J, Cui G, Suo
            S and Peng G.
  TITLE     Three-dimensional molecular architecture of mouse organogenesis
  JOURNAL   Nat Commun 14 (1), 4599 (2023)
   PUBMED   37524711
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 773)
  AUTHORS   Rossitto M, Dejardin S, Rands CM, Le Gras S, Migale R, Rafiee MR,
            Neirijnck Y, Pruvost A, Nguyen AL, Bossis G, Cammas F, Le Gallic L,
            Wilhelm D, Lovell-Badge R, Boizet-Bonhoure B, Nef S and Poulat F.
  TITLE     TRIM28-dependent SUMOylation protects the adult ovary from
            activation of the testicular pathway
  JOURNAL   Nat Commun 13 (1), 4412 (2022)
   PUBMED   35906245
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 773)
  AUTHORS   Prokopuk L, Jarred EG, Blucher RO, McLaughlin EA, Stringer JM and
            Western PS.
  TITLE     An essential role for Polycomb Repressive Complex 2 in the mouse
            ovary
  JOURNAL   Reproduction 163 (3), 167-182 (2022)
   PUBMED   35084365
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 773)
  AUTHORS   Zhao L, Thomson E, Ng ET, Longmuss E, Svingen T, Bagheri-Fam S,
            Quinn A, Harley VR, Harrison LC, Pelosi E and Koopman P.
  TITLE     Functional Analysis of Mmd2 and Related PAQR Genes During Sex
            Determination in Mice
  JOURNAL   Sex Dev 16 (4), 270-282 (2022)
   PUBMED   35306493
REFERENCE   6  (bases 1 to 773)
  AUTHORS   Bingham CO 3rd, Murakami M, Fujishima H, Hunt JE, Austen KF and Arm
            JP.
  TITLE     A heparin-sensitive phospholipase A2 and prostaglandin endoperoxide
            synthase-2 are functionally linked in the delayed phase of
            prostaglandin D2 generation in mouse bone marrow-derived mast cells
  JOURNAL   J Biol Chem 271 (42), 25936-25944 (1996)
   PUBMED   8824228
REFERENCE   7  (bases 1 to 773)
  AUTHORS   Pilz A, Woodward K, Povey S and Abbott C.
  TITLE     Comparative mapping of 50 human chromosome 9 loci in the laboratory
            mouse
  JOURNAL   Genomics 25 (1), 139-149 (1995)
   PUBMED   7774911
REFERENCE   8  (bases 1 to 773)
  AUTHORS   Chan P, Simon-Chazottes D, Mattei MG, Guenet JL and Salier JP.
  TITLE     Comparative mapping of lipocalin genes in human and mouse: the four
            genes for complement C8 gamma chain, prostaglandin-D-synthase,
            oncogene-24p3, and progestagen-associated endometrial protein map
            to HSA9 and MMU2
  JOURNAL   Genomics 23 (1), 145-150 (1994)
   PUBMED   7829063
REFERENCE   9  (bases 1 to 773)
  AUTHORS   Igarashi M, Nagata A, Toh H, Urade Y and Hayaishi O.
  TITLE     Structural organization of the gene for prostaglandin D synthase in
            the rat brain
  JOURNAL   Proc Natl Acad Sci U S A 89 (12), 5376-5380 (1992)
   PUBMED   1608945
REFERENCE   10 (bases 1 to 773)
  AUTHORS   Spies T and DeMars R.
  TITLE     Restored expression of major histocompatibility class I molecules
            by gene transfer of a putative peptide transporter
  JOURNAL   Nature 351 (6324), 323-324 (1991)
   PUBMED   2034277
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL732557.4.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CD776351.1, CO039447.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849381, SAMN01164131
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-190               AL732557.4         142333-142522       c
            191-330             AL732557.4         141761-141900       c
            331-407             AL732557.4         141606-141682       c
            408-524             AL732557.4         140845-140961       c
            525-626             AL732557.4         140591-140692       c
            627-652             AL732557.4         140093-140118       c
            653-773             AL732557.4         139484-139604       c
FEATURES             Location/Qualifiers
     source          1..773
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="2"
                     /map="2 17.28 cM"
     gene            1..773
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="prostaglandin D2 synthase (brain)"
                     /db_xref="GeneID:19215"
                     /db_xref="MGI:MGI:99261"
     exon            1..190
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     CDS             77..646
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /EC_number="5.3.99.2"
                     /note="lipocalin-type prostaglandin-D synthase;
                     prostaglandin-H2 D-isomerase; glutathione-independent PGD
                     synthetase; PGD2 synthase; prostaglandin-D2 synthase;
                     glutathione-independent PGD synthase; prostaglandin D2
                     synthase (21 kDa, brain)"
                     /codon_start=1
                     /product="prostaglandin-H2 D-isomerase precursor"
                     /protein_id="NP_001407674.1"
                     /db_xref="GeneID:19215"
                     /db_xref="MGI:MGI:99261"
                     /translation="
MAALRMLWMGLVLLGLLGFPQTPAQGHDTVQPNFQQDKFLGRWYSAGLASNSSWFREKKAVLYMCKTVVAPSTEGGLNLTSTFLRKNQCETKIMVLQPAGAPGHYTYSSPHSGSIHSVSVVEANYDEYALLFSRGTKGPGQDFRMATLYSRTQTLKDELKEKFTTFSKAQGLTEEDIVFLPQPDKCIQE"
     sig_peptide     77..148
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     mat_peptide     149..643
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /product="Prostaglandin-H2 D-isomerase.
                     /id=PRO_0000017947"
                     /note="propagated from UniProtKB/Swiss-Prot (O09114.1)"
     misc_feature    149..151
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="Pyrrolidone carboxylic acid.
                     /evidence=ECO:0000250|UniProtKB:P22057; propagated from
                     UniProtKB/Swiss-Prot (O09114.1);
                     pyrrolidone-carboxylic-acid site"
     misc_feature    164..640
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="lipocalin-type prostaglandin D synthase; Region:
                     lipocalin_L-PGDS; cd19419"
                     /db_xref="CDD:381194"
     misc_feature    order(191..193,203..205,209..211,227..232,236..241,
                     248..253,260..262,266..268,275..277,281..283,305..307,
                     311..313,317..319,323..325,350..358,362..364,389..391,
                     395..397,410..412,422..424,428..430,434..436,461..463,
                     467..469,473..475,509..511,515..517,521..523)
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="ligand binding cavity [chemical binding]; other
                     site"
                     /db_xref="CDD:381194"
     misc_feature    227..229
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (O09114.1); glycosylation site"
     misc_feature    308..310
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000250; propagated from
                     UniProtKB/Swiss-Prot (O09114.1); glycosylation site"
     exon            191..330
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     exon            331..407
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     exon            408..524
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     exon            525..626
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     exon            627..652
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
     exon            653..773
                     /gene="Ptgds"
                     /gene_synonym="21kDa; L-PGDS; PGD2; PGDS; PGDS2; Ptgs3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gctccttctgcccagttttccttgctttgtccacattgctggcatcaggcccaggcacctgctctgctctgagcaaatggctgctcttcgcatgctgtggatgggtttggtcctcctgggtctcttgggattcccacagaccccagcccagggccatgacacagtgcagcccaactttcaacaagacaagttcctggggcgctggtacagcgcgggcctcgcctccaactcaagctggttccgggagaagaaagctgtattgtatatgtgcaagacagtggtagccccctccacagaaggcggcctcaatctcacctctaccttcctcaggaaaaaccagtgtgagaccaagatcatggtactgcagcctgcgggggctcctggacactacacctacagcagcccccactcgggcagcatccactccgtgtcagtggtggaggccaactatgacgagtacgctctgctattcagcagaggcaccaagggcccaggccaggacttccgcatggccaccctctacagcagaacccagactctgaaggacgagctgaaggagaaattcaccacctttagcaaggcccagggcctcacagaggaggacattgttttcctgccccaaccggataagtgcattcaagagtaaacgcaggtgacctggcctcaggactcctttgctctgtcactctcaagatcccagccctggctccccaaagtacctctacaccctccagctttgccttgacaaagaaataaaagtccaaagcaagtca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]