GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-29 07:22:15, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001418481             931 bp    mRNA    linear   ROD 24-SEP-2023
DEFINITION  Mus musculus endoplasmic reticulum oxidoreductase 1 beta (Ero1b),
            transcript variant 5, mRNA.
ACCESSION   NM_001418481
VERSION     NM_001418481.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 931)
  AUTHORS   Parveen N, Wang JK, Bhattacharya S, Cuala J, Rajkumar MS, Butler
            AE, Wu X, Shih HP, Georgia SK and Dhawan S.
  TITLE     DNA Methylation-Dependent Restriction of Tyrosine Hydroxylase
            Contributes to Pancreatic beta-Cell Heterogeneity
  JOURNAL   Diabetes 72 (5), 575-589 (2023)
   PUBMED   36607262
  REMARK    Erratum:[Diabetes. 2023 Sep 08;:. PMID: 37683666]
REFERENCE   2  (bases 1 to 931)
  AUTHORS   Jang I, Pottekat A, Poothong J, Yong J, Lagunas-Acosta J, Charbono
            A, Chen Z, Scheuner DL, Liu M, Itkin-Ansari P, Arvan P and Kaufman
            RJ.
  TITLE     PDIA1/P4HB is required for efficient proinsulin maturation and ss
            cell health in response to diet induced obesity
  JOURNAL   Elife 8, e44528 (2019)
   PUBMED   31184304
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 931)
  AUTHORS   Flodby P, Li C, Liu Y, Wang H, Marconett CN, Laird-Offringa IA,
            Minoo P, Lee AS and Zhou B.
  TITLE     The 78-kD Glucose-Regulated Protein Regulates Endoplasmic Reticulum
            Homeostasis and Distal Epithelial Cell Survival during Lung
            Development
  JOURNAL   Am J Respir Cell Mol Biol 55 (1), 135-149 (2016)
   PUBMED   26816051
REFERENCE   4  (bases 1 to 931)
  AUTHORS   Wang DY, Abbasi C, El-Rass S, Li JY, Dawood F, Naito K, Sharma P,
            Bousette N, Singh S, Backx PH, Cox B, Wen XY, Liu PP and Gramolini
            AO.
  TITLE     Endoplasmic reticulum resident protein 44 (ERp44) deficiency in
            mice and zebrafish leads to cardiac developmental and functional
            defects
  JOURNAL   J Am Heart Assoc 3 (5), e001018 (2014)
   PUBMED   25332179
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 931)
  AUTHORS   Awazawa M, Futami T, Sakada M, Kaneko K, Ohsugi M, Nakaya K, Terai
            A, Suzuki R, Koike M, Uchiyama Y, Kadowaki T and Ueki K.
  TITLE     Deregulation of pancreas-specific oxidoreductin ERO1beta in the
            pathogenesis of diabetes mellitus
  JOURNAL   Mol Cell Biol 34 (7), 1290-1299 (2014)
   PUBMED   24469402
  REMARK    GeneRIF: in diabetic model mice, ERO1beta expression is
            paradoxically decreased in beta cells despite the indications of
            increased ER stress
REFERENCE   6  (bases 1 to 931)
  AUTHORS   Khoo C, Yang J, Rajpal G, Wang Y, Liu J, Arvan P and Stoffers DA.
  TITLE     Endoplasmic reticulum oxidoreductin-1-like beta (ERO1lbeta)
            regulates susceptibility to endoplasmic reticulum stress and is
            induced by insulin flux in beta-cells
  JOURNAL   Endocrinology 152 (7), 2599-2608 (2011)
   PUBMED   21540283
  REMARK    GeneRIF: Several lines of evidence suggest that ERO1lbeta is
            involved in maintaining insulin content of pancreatic beta cells
            and in regulating beta cell survival during ER oxidative stress.
REFERENCE   7  (bases 1 to 931)
  AUTHORS   Zito E, Melo EP, Yang Y, Wahlander A, Neubert TA and Ron D.
  TITLE     Oxidative protein folding by an endoplasmic reticulum-localized
            peroxiredoxin
  JOURNAL   Mol Cell 40 (5), 787-797 (2010)
   PUBMED   21145486
REFERENCE   8  (bases 1 to 931)
  AUTHORS   Appenzeller-Herzog C, Riemer J, Zito E, Chin KT, Ron D, Spiess M
            and Ellgaard L.
  TITLE     Disulphide production by Ero1alpha-PDI relay is rapid and
            effectively regulated
  JOURNAL   EMBO J 29 (19), 3318-3329 (2010)
   PUBMED   20802462
REFERENCE   9  (bases 1 to 931)
  AUTHORS   Zito E, Chin KT, Blais J, Harding HP and Ron D.
  TITLE     ERO1-beta, a pancreas-specific disulfide oxidase, promotes insulin
            biogenesis and glucose homeostasis
  JOURNAL   J Cell Biol 188 (6), 821-832 (2010)
   PUBMED   20308425
  REMARK    GeneRIF: An unexpectedly selective function for ERO1-beta in
            oxidative protein folding in insulin-producing cells that is
            required for glucose homeostasis in vivo.
            Erratum:[J Cell Biol. 2010 May 17;189(4):769]
REFERENCE   10 (bases 1 to 931)
  AUTHORS   Aksu S, Koczan D, Renne U, Thiesen HJ and Brockmann GA.
  TITLE     Differentially expressed genes in adipose tissues of high body
            weight-selected (obese) and unselected (lean) mouse lines
  JOURNAL   J Appl Genet 48 (2), 133-143 (2007)
   PUBMED   17495347
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CT954220.7.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13422601.1213110.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849374, SAMN00849375
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-271               CT954220.7         98193-98463
            272-391             CT954220.7         107105-107224
            392-475             CT954220.7         111461-111544
            476-517             CT954220.7         112659-112700
            518-600             CT954220.7         113954-114036
            601-674             CT954220.7         115822-115895
            675-795             CT954220.7         123046-123166
            796-842             CT954220.7         123270-123316
            843-931             CT954220.7         125793-125881
FEATURES             Location/Qualifiers
     source          1..931
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="13"
                     /map="13 5.07 cM"
     gene            1..931
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /note="endoplasmic reticulum oxidoreductase 1 beta"
                     /db_xref="GeneID:67475"
                     /db_xref="MGI:MGI:1914725"
     exon            1..271
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     CDS             170..883
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /note="isoform 5 precursor is encoded by transcript
                     variant 5; ERO1-like protein beta; endoplasmic
                     oxidoreductase 1 beta; ERO1-L-beta;
                     oxidoreductin-1-L-beta; endoplasmic oxidoreductin-1-like
                     protein B; endoplasmic reticulum oxidoreductin-1-like
                     protein B; endoplasmic reticulum oxidoreductase beta;
                     ERO1-like beta"
                     /codon_start=1
                     /product="ERO1-like protein beta isoform 5 precursor"
                     /protein_id="NP_001405410.1"
                     /db_xref="GeneID:67475"
                     /db_xref="MGI:MGI:1914725"
                     /translation="
MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCDIDSIDKFNTYKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAINSTLSNESKEAFIDWARYDDSQDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGELKLLCLL"
     sig_peptide     170..268
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="COORDINATES: ab initio prediction:SignalP:4.0"
     misc_feature    335..>877
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /note="Endoplasmic Reticulum Oxidoreductin 1 (ERO1);
                     Region: ERO1; cl19883"
                     /db_xref="CDD:450398"
     exon            272..391
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            392..475
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            476..517
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            518..600
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            601..674
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            675..795
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            796..842
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
     exon            843..931
                     /gene="Ero1b"
                     /gene_synonym="1300013B24Rik; 1700065B09Rik; ero1-beta;
                     Ero1lb"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agtcgctgctgctgcgaacggtagagtgttccttgcccgagaccggcgctcagaccccgggtcctggaggctcccggctcccaggcactgccccctgctgtcgtcgtcgcggcgggccgtcgttccccagccccgatcggccgaggcgacggcagcggccgaggtcaccatgagtccggggttccgccgggccgttactgggcagggggcggcggccgcggtgcaactgcttgtcaccctgagcttcctctcaagtctggtcaagactcaggtgactggagttctggatgattgcttatgtgacattgacagcattgataaattcaacacctacaaaatctttcccaaaataaagaagttacaagaacgagactattttcgttattacaaggttaatctgaaacgaccatgtcctttctgggcagaagatggccactgctcaataaaagactgtcatgtggagccctgtccagaaagtaaaattccagttggaattaaagccgggcgttcaaataagtactcgcaagcagcaaacagcaccaaagaactggatgactgtgagcaggctaacaaactgggcgccatcaacagcacgctaagtaacgaaagcaaagaagcgttcattgactgggcgagatatgatgattcgcaggaccacttttgtgaacttgatgatgagcggtctcctgctgcacagtatgtggacctgctgctgaacccggaacggtacactggctacaagggctcctcagcatggagggtgtggaacagcatctatgaagaaaactgcttcaagcctcgatctgtttatcgtcctttaaatcctttggcgcccagcagaggggaagatgatggtgagttgaaactcttgtgtttactttaaccatgaaagaagtctttttactattaaatatttggtgtttttctttca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]