2024-05-05 18:45:11, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001417315 837 bp mRNA linear ROD 26-SEP-2023 DEFINITION Mus musculus SWA-70 protein (Swap70), transcript variant 2, mRNA. ACCESSION NM_001417315 VERSION NM_001417315.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 837) AUTHORS Qian Q, Hu F, Yu W, Leng D, Li Y, Shi H, Deng D, Ding K, Liang C and Liu J. TITLE SWAP70 Overexpression Protects Against Pathological Cardiac Hypertrophy in a TAK1-Dependent Manner JOURNAL J Am Heart Assoc 12 (7), e028628 (2023) PUBMED 36974751 REMARK GeneRIF: SWAP70 Overexpression Protects Against Pathological Cardiac Hypertrophy in a TAK1-Dependent Manner. REFERENCE 2 (bases 1 to 837) AUTHORS Chen Z, Flores Castro D, Gupta S, Phalke S, Manni M, Rivera-Correa J, Jessberger R, Zaghouani H, Giannopoulou E, Pannellini T and Pernis AB. TITLE Interleukin-13 Receptor alpha1-Mediated Signaling Regulates Age-Associated/Autoimmune B Cell Expansion and Lupus Pathogenesis JOURNAL Arthritis Rheumatol 74 (9), 1544-1555 (2022) PUBMED 35438841 REFERENCE 3 (bases 1 to 837) AUTHORS Dohnke S, Moehser S, Surnov A, Kurth T, Jessberger R, Kretschmer K and Garbe AI. TITLE Role of Dynamic Actin Cytoskeleton Remodeling in Foxp3+ Regulatory T Cell Development and Function: Implications for Osteoclastogenesis JOURNAL Front Immunol 13, 836646 (2022) PUBMED 35359955 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 837) AUTHORS Ricker E, Manni M, Flores-Castro D, Jenkins D, Gupta S, Rivera-Correa J, Meng W, Rosenfeld AM, Pannellini T, Bachu M, Chinenov Y, Sculco PK, Jessberger R, Prak ETL and Pernis AB. TITLE Altered function and differentiation of age-associated B cells contribute to the female bias in lupus mice JOURNAL Nat Commun 12 (1), 4813 (2021) PUBMED 34376664 REMARK Publication Status: Online-Only REFERENCE 5 (bases 1 to 837) AUTHORS Bedogni F and Hevner RF. TITLE Cell-Type-Specific Gene Expression in Developing Mouse Neocortex: Intermediate Progenitors Implicated in Axon Development JOURNAL Front Mol Neurosci 14, 686034 (2021) PUBMED 34321999 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 837) AUTHORS Gross B, Borggrefe T, Wabl M, Sivalenka RR, Bennett M, Rossi AB and Jessberger R. TITLE SWAP-70-deficient mast cells are impaired in development and IgE-mediated degranulation JOURNAL Eur J Immunol 32 (4), 1121-1128 (2002) PUBMED 11920580 REMARK GeneRIF: In mast cells SWAP-70 plays a role both in establishing the initial competence to degranulate and to develop into mature mast cells. REFERENCE 7 (bases 1 to 837) AUTHORS Borggrefe T, Keshavarzi S, Gross B, Wabl M and Jessberger R. TITLE Impaired IgE response in SWAP-70-deficient mice JOURNAL Eur J Immunol 31 (8), 2467-2475 (2001) PUBMED 11500831 REMARK GeneRIF: SWAP-70 deficient mice exhibit B cell anomalies including increased autoantibody production and impaired isotype switching. REFERENCE 8 (bases 1 to 837) AUTHORS Masat L, Liddell RA, Mock BA, Kuo WL, Jessberger R, Wabl M and Morse HC 3rd. TITLE Mapping of the SWAP70 gene to mouse chromosome 7 and human chromosome 11p15 JOURNAL Immunogenetics 51 (1), 16-19 (2000) PUBMED 10663557 REFERENCE 9 (bases 1 to 837) AUTHORS Borggrefe T, Masat L, Wabl M, Riwar B, Cattoretti G and Jessberger R. TITLE Cellular, intracellular, and developmental expression patterns of murine SWAP-70 JOURNAL Eur J Immunol 29 (6), 1812-1822 (1999) PUBMED 10382743 REFERENCE 10 (bases 1 to 837) AUTHORS Borggrefe T, Wabl M, Akhmedov AT and Jessberger R. TITLE A B-cell-specific DNA recombination complex JOURNAL J Biol Chem 273 (27), 17025-17035 (1998) PUBMED 9642267 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC147244.2 and AC124472.4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: CJ135859.1, BY754522.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375, SAMN00849380 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-158 AC147244.2 851-1008 c 159-299 AC124472.4 151256-151396 c 300-473 AC124472.4 138872-139045 c 474-837 AC124472.4 130537-130900 c FEATURES Location/Qualifiers source 1..837 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="7" /map="7 57.7 cM" gene 1..837 /gene="Swap70" /gene_synonym="70kDa" /note="SWA-70 protein" /db_xref="GeneID:20947" /db_xref="MGI:MGI:1298390" exon 1..158 /gene="Swap70" /gene_synonym="70kDa" /inference="alignment:Splign:2.1.0" misc_feature 39..41 /gene="Swap70" /gene_synonym="70kDa" /note="upstream in-frame stop codon" CDS 60..716 /gene="Swap70" /gene_synonym="70kDa" /note="isoform 2 is encoded by transcript variant 2; switch-associated protein 70; SWAP-70; SWAP complex protein, 70 kDa" /codon_start=1 /product="switch-associated protein 70 isoform 2" /protein_id="NP_001404244.1" /db_xref="GeneID:20947" /db_xref="MGI:MGI:1298390" /translation="
MRGLKDELLKAIWHAFTALDLDRSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEDDAFKVWVIFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDNKDGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQVRGP"
exon 159..299 /gene="Swap70" /gene_synonym="70kDa" /inference="alignment:Splign:2.1.0" exon 300..473 /gene="Swap70" /gene_synonym="70kDa" /inference="alignment:Splign:2.1.0" exon 474..837 /gene="Swap70" /gene_synonym="70kDa" /inference="alignment:Splign:2.1.0" ORIGIN
agaggcgctgagttgccgactgggctgaccaggtctgttagggcagcgcggccgcggccatgaggggcttgaaagacgaactgctcaaagccatttggcacgccttcaccgcgctcgacctggaccgcagcggcaaggtctccaagtcgcaactcaaggtcctttcccataacctgtgcacggtgctgaaggttccacatgacccggttgcccttgaggagcactttagggatgacgatgaggggcctgtctccaatcagggctacatgccatatttaaacaagttcattttggaaaaggtccaagacaactttgacaagattgaattcaatagaatgtgttggacactttgtgtcaagaaaaacctcacaaagagtcctctactcattacagaagatgatgcatttaaagtgtgggtcattttcaactttttgtcagaggacaagtatccactaattattgtgccagaagagattgaatacctgcttaagaagcttacagaagctatgggaggaggttggcaacaagaacaatttgaacattacaaaataaactttgatgacaataaagatggcctttctgcatgggaacttattgagctaattgggaatggacagtttagcaagggcatggaccgtcagaccgtatctatggccattaacgaagtcttcaatgagcttattttagatgtattgaagcaggtaagagggccatagcactttctctctcatctttagattctgatgtttgagaccaaatagcttccttccctctccataagtcacttatactctttaaatgatttagaacaaaaataaagttttctgttttctctgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]