2024-03-28 20:59:06, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001378990 1832 bp mRNA linear ROD 29-DEC-2022 DEFINITION Mus musculus ankyrin repeat domain 54 (Ankrd54), transcript variant 4, mRNA. ACCESSION NM_001378990 XM_030248500 VERSION NM_001378990.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1832) AUTHORS Gustafsson MO, Hussain A, Mohammad DK, Mohamed AJ, Nguyen V, Metalnikov P, Colwill K, Pawson T, Smith CI and Nore BF. TITLE Regulation of nucleocytoplasmic shuttling of Bruton's tyrosine kinase (Btk) through a novel SH3-dependent interaction with ankyrin repeat domain 54 (ANKRD54) JOURNAL Mol Cell Biol 32 (13), 2440-2453 (2012) PUBMED 22527282 REMARK GeneRIF: Liar is the first protein identified that specifically influences the nucleocytoplasmic shuttling of Btk and Txk and belongs to a rare group of known proteins carrying out this activity in a Crm1-dependent manner. REFERENCE 2 (bases 1 to 1832) AUTHORS Yokoyama S, Ito Y, Ueno-Kudoh H, Shimizu H, Uchibe K, Albini S, Mitsuoka K, Miyaki S, Kiso M, Nagai A, Hikata T, Osada T, Fukuda N, Yamashita S, Harada D, Mezzano V, Kasai M, Puri PL, Hayashizaki Y, Okado H, Hashimoto M and Asahara H. TITLE A systems approach reveals that the myogenesis genome network is regulated by the transcriptional repressor RP58 JOURNAL Dev Cell 17 (6), 836-848 (2009) PUBMED 20059953 REFERENCE 3 (bases 1 to 1832) AUTHORS Samuels AL, Klinken SP and Ingley E. TITLE Liar, a novel Lyn-binding nuclear/cytoplasmic shuttling protein that influences erythropoietin-induced differentiation JOURNAL Blood 113 (16), 3845-3856 (2009) PUBMED 19064729 REMARK GeneRIF: Liar is a novel Lyn-interacting molecule that plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation. REFERENCE 4 (bases 1 to 1832) AUTHORS McClintock TS, Glasser CE, Bose SC and Bergman DA. TITLE Tissue expression patterns identify mouse cilia genes JOURNAL Physiol Genomics 32 (2), 198-206 (2008) PUBMED 17971504 REMARK GeneRIF: Ankrd54 is most abundantly expressed in tissues rich in highly ciliated cells, such as olfactory sensory neurons, and is predicted to be important to cilia. REFERENCE 5 (bases 1 to 1832) AUTHORS Southard-Smith EM, Collins JE, Ellison JS, Smith KJ, Baxevanis AD, Touchman JW, Green ED, Dunham I and Pavan WJ. TITLE Comparative analyses of the Dominant megacolon-SOX10 genomic interval in mouse and human JOURNAL Mamm Genome 10 (7), 744-749 (1999) PUBMED 10384052 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL589670.21. On Mar 17, 2020 this sequence version replaced XM_030248500.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## Transcript exon combination :: SRR7345562.793322.1, SRR11927938.3831013.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164142 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-446 AL589670.21 75000-75445 447-494 AL589670.21 76707-76754 495-566 AL589670.21 81833-81904 567-614 AL589670.21 82376-82423 615-739 AL589670.21 82502-82626 740-847 AL589670.21 83315-83422 848-1832 AL589670.21 83834-84818 FEATURES Location/Qualifiers source 1..1832 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="15" /map="15 37.7 cM" gene 1..1832 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /note="ankyrin repeat domain 54" /db_xref="GeneID:223690" /db_xref="MGI:MGI:2444209" exon 1..446 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" CDS 122..922 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /note="isoform 4 is encoded by transcript variant 4; ankyrin repeat domain-containing protein 54; lyn-interacting ankyrin repeat protein" /codon_start=1 /product="ankyrin repeat domain-containing protein 54 isoform 4" /protein_id="NP_001365919.1" /db_xref="GeneID:223690" /db_xref="MGI:MGI:2444209" /translation="
MAATGGGADDESRSGRSSSDGECAVAPEPLAEAGGLVSFADFGVSLGSGAGLPGRSVGRAQSSLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQLLLDHGADPNQQDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQIIHMLREYLERLGRHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR"
misc_feature 470..715 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /note="Ankyrin repeats (3 copies); Region: Ank_2; pfam12796" /db_xref="CDD:432791" misc_feature order(473..481,485..490,500..502,509..511,536..538, 542..544,548..550,560..565,572..580,584..589,599..601, 608..610,635..637,641..643,647..649,659..664,689..697, 701..706,716..718) /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /note="oligomer interface [polypeptide binding]; other site" /db_xref="CDD:293786" misc_feature 542..637 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /note="ANK repeat [structural motif]; Region: ANK repeat" /db_xref="CDD:293786" exon 447..494 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" exon 495..566 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" exon 567..614 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" exon 615..739 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" exon 740..847 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" exon 848..1832 /gene="Ankrd54" /gene_synonym="C730048E16Rik; EST1068184; EST475269; Liar" /inference="alignment:Splign:2.1.0" ORIGIN
gctgtggttgcaggccccgcccgtccgttcgctgacagcgaggcttctcctggagggaagcgggtccgttggtcggttcggagcgaggctggcgctgccaggcccgcgcctagccgttgccatggcagccaccggcgggggcgcggacgacgagtcgcgatccggccgctcgagctcggacggcgagtgcgcggtggcgccggagcctttggcggaagccggaggcctggtgtctttcgcggacttcggcgtttcgctgggcagcggcgccggcctcccgggccggtcggtgggcagggcccagtcctcgctgcgctacctccaggtcctgtggcagcaggacgtcgagcctcgcgacgaactgcgttgcaagattcccgccgggcggttgaggcgtgccgccaggccccaccgtcggctcgggcccaccggcaaggaggtacacgctctgaagaggctgagggactctgccaatgccaacgacgtagaaacagtgcagctgctcctggaccatggggctgaccccaaccaacaggatggtctgggcaacacgccattgcacctggcggcctgcaccaaccatgttcctgtcatcaccacactgcttcgaggaggggcccgtgtagatgccctagacagagctggccgcacacccctacacctggccaagtcgaagctgaacatcctacaggagggtcattcccagtgtctggaggccgtccgcctggaggtgaagcagatcatccacatgctacgcgagtacctggagcgcctggggcggcatgagcagcgagaacggctagatgacctctgcacccgcctccagatgacaagtaccaaagaacaggtggatgaagtgacggacctcttggccagcttcacctccctcagtctgcagatgcagagtatggagaagaggtagcaagggaggctgctccttgctttgccgccgccctcctgccctctgagctcgctaccgggaaagcccagggaactctggagttcaccttgcccttgcccttagatgccgagggcagaactgacagtctgcgtcatctctctgggtcgggaccacagcccctgctcctgctgcataatgccagcctctgtagccacattccaggcccacacgtgctgttgtagcagacaccactcctcccgtggcctccctgtgcccacagcacacctcagagccctctagttcttcccagccatgggctctgttcctgtcatctggctgacactctgaggccacccgggctgctttgggtctctaagcttgtcctgccccttacaccagcacttcagtgtagccctgctccttccttccaaggaaacactgcactgtctctgagcagaagagggacattgctcaagattaggaaggacctggtttagcccaaagaaagctctgcagctccttcccccgcaatcactgaaacactacgaatgggcgtccgttttgcagcccagttctcagtgattgatagtgggtcatgggctcaggtccttatcccaggatcctctaagccttaggtgttgtggcaagagtctgtacagatatataactagaggtattcagctgagagggtcctggatcacctaggtgagctgggtatcactccagggagccctggaggaggaggcaggaggtgactggcaccatgtggatgtgagatgttgagaaagaagctgggagccggcagaggacaggcagtgggtccctcggaacctccagcagggactggctctgctgacagatacaccagagcccagccagacatgtttttatttctggcctccacaattgtgaaaagaaatctgttggttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]