ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-11-01 08:06:54, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001317173 7255 bp mRNA linear ROD 13-MAY-2024
DEFINITION Mus musculus argonaute RISC catalytic subunit 1 (Ago1), transcript
variant 1, mRNA.
ACCESSION NM_001317173
VERSION NM_001317173.1
KEYWORDS RefSeq.
SOURCE Mus musculus (house mouse)
ORGANISM Mus musculus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE 1 (bases 1 to 7255)
AUTHORS Liu,Q., Pepin,R.M., Novak,M.K., Maschhoff,K.R., Worner,K. and Hu,W.
TITLE AGO1 controls protein folding in mouse embryonic stem cell fate
decisions
JOURNAL Dev Cell 59 (8), 979-990 (2024)
PUBMED 38458189
REMARK GeneRIF: AGO1 controls protein folding in mouse embryonic stem cell
fate decisions.
REFERENCE 2 (bases 1 to 7255)
AUTHORS Adams,D.J., Barlas,B., McIntyre,R.E., Salguero,I., van der
Weyden,L., Barros,A., Vicente,J.R., Karimpour,N., Haider,A.,
Ranzani,M., Turner,G., Thompson,N.A., Harle,V., Olvera-Leon,R.,
Robles-Espinoza,C.D., Speak,A.O., Geisler,N., Weninger,W.J.,
Geyer,S.H., Hewinson,J., Karp,N.A., Fu,B., Yang,F., Kozik,Z.,
Choudhary,J., Yu,L., van Ruiten,M.S., Rowland,B.D., Lelliott,C.J.,
Del Castillo Velasco-Herrera,M., Verstraten,R., Bruckner,L.,
Henssen,A.G., Rooimans,M.A., de Lange,J., Mohun,T.J., Arends,M.J.,
Kentistou,K.A., Coelho,P.A., Zhao,Y., Zecchini,H., Perry,J.R.B.,
Jackson,S.P. and Balmus,G.
CONSRTM Sanger Mouse Genetics Project
TITLE Genetic determinants of micronucleus formation in vivo
JOURNAL Nature 627 (8002), 130-136 (2024)
PUBMED 38355793
REFERENCE 3 (bases 1 to 7255)
AUTHORS Muller,M., Fah,T., Schaefer,M., Hermes,V., Luitz,J., Stalder,P.,
Arora,R., Ngondo,R.P. and Ciaudo,C.
TITLE AGO1 regulates pericentromeric regions in mouse embryonic stem
cells
JOURNAL Life Sci Alliance 5 (6), e202101277 (2022)
PUBMED 35236760
REMARK GeneRIF: AGO1 regulates pericentromeric regions in mouse embryonic
stem cells.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 7255)
AUTHORS Zhang,Y., Tan,Y.Y., Chen,P.P., Xu,H., Xie,S.J., Xu,S.J., Li,B.,
Li,J.H., Liu,S., Yang,J.H., Zhou,H. and Qu,L.H.
TITLE Genome-wide identification of microRNA targets reveals positive
regulation of the Hippo pathway by miR-122 during liver development
JOURNAL Cell Death Dis 12 (12), 1161 (2021)
PUBMED 34907157
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 7255)
AUTHORS Eswarappa,S.M., Potdar,A.A., Koch,W.J., Fan,Y., Vasu,K.,
Lindner,D., Willard,B., Graham,L.M., DiCorleto,P.E. and Fox,P.L.
TITLE Programmed translational readthrough generates antiangiogenic
VEGF-Ax
JOURNAL Cell 157 (7), 1605-1618 (2014)
PUBMED 24949972
REFERENCE 6 (bases 1 to 7255)
AUTHORS Stryke,D., Kawamoto,M., Huang,C.C., Johns,S.J., King,L.A.,
Harper,C.A., Meng,E.C., Lee,R.E., Yee,A., L'Italien,L.,
Chuang,P.T., Young,S.G., Skarnes,W.C., Babbitt,P.C. and Ferrin,T.E.
TITLE BayGenomics: a resource of insertional mutations in mouse embryonic
stem cells
JOURNAL Nucleic Acids Res 31 (1), 278-281 (2003)
PUBMED 12520002
REFERENCE 7 (bases 1 to 7255)
AUTHORS Carmell,M.A., Xuan,Z., Zhang,M.Q. and Hannon,G.J.
TITLE The Argonaute family: tentacles that reach into RNAi, developmental
control, stem cell maintenance, and tumorigenesis
JOURNAL Genes Dev 16 (21), 2733-2742 (2002)
PUBMED 12414724
REMARK Review article
REFERENCE 8 (bases 1 to 7255)
AUTHORS Beier,H. and Grimm,M.
TITLE Misreading of termination codons in eukaryotes by natural nonsense
suppressor tRNAs
JOURNAL Nucleic Acids Res 29 (23), 4767-4782 (2001)
PUBMED 11726686
REMARK Review article
REFERENCE 9 (bases 1 to 7255)
AUTHORS Cikaluk,D.E., Tahbaz,N., Hendricks,L.C., DiMattia,G.E., Hansen,D.,
Pilgrim,D. and Hobman,T.C.
TITLE GERp95, a membrane-associated protein that belongs to a family of
proteins involved in stem cell differentiation
JOURNAL Mol Biol Cell 10 (10), 3357-3372 (1999)
PUBMED 10512872
REMARK GeneRIF: describes cloning rat sequence and used RNA interference
to show that the GERp95 orthologue in C. elegans is important for
maturation of germ-line stem cells in the gonad.
REFERENCE 10 (bases 1 to 7255)
AUTHORS Araki,K., Imaizumi,T., Sekimoto,T., Yoshinobu,K., Yoshimuta,J.,
Akizuki,M., Miura,K., Araki,M. and Yamamura,K.
TITLE Exchangeable gene trap using the Cre/mutated lox system
JOURNAL Cell Mol Biol (Noisy-le-grand) 45 (5), 737-750 (1999)
PUBMED 10512203
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CJ130124.1, BC129914.1,
AK080954.1, CV559803.1, AL606976.25 and AI451331.1.
Summary: This gene encodes a member of the argonaute family of
proteins, which associate with small RNAs and have important roles
in RNA interference (RNAi) and RNA silencing. This protein binds to
microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses
translation of mRNAs that are complementary to them. It is also
involved in transcriptional gene silencing (TGS) of promoter
regions that are complementary to bound short antigene RNAs
(agRNAs), as well as in the degradation of miRNA-bound mRNA
targets. Alternatively spliced transcript variants encoding
different isoforms have been found for this gene. A recent study
showed this gene to be an authentic stop codon readthrough target,
and that its mRNA could give rise to an additional C-terminally
extended isoform by use of an alternative in-frame translation
termination codon. [provided by RefSeq, Nov 2015].
Transcript Variant: This variant (1) represents the predominant
transcript and encodes two isoforms, which result from the use of
alternative in-frame translation termination codons. The shorter
isoform (1) results from translation termination at the upstream
UGA stop codon, while the longer isoform (1x) results from UGA stop
codon readthrough to the downstream UAG termination codon. This
RefSeq represents the longer, C-terminally extended isoform (1x).
As the UGA stop codon has been reported to specify several
alternative amino acids (tryptophan, cysteine, arginine and
serine), its location in the longer isoform is denoted by an 'X'.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC129914.1, AB081471.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMN00849374,
SAMN00849375 [ECO:0006172]
##Evidence-Data-END##
##RefSeq-Attributes-START##
stop codon readthrough :: inferred from conservation
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-162 CJ130124.1 2-163
163-2736 BC129914.1 1-2574
2737-3224 AK080954.1 2425-2912
3225-3556 CV559803.1 331-662
3557-7095 AL606976.25 152062-155600 c
7096-7255 AI451331.1 2-161
FEATURES Location/Qualifiers
source 1..7255
/organism="Mus musculus"
/mol_type="mRNA"
/strain="C57BL/6"
/db_xref="taxon:10090"
/chromosome="4"
/map="4 60.76 cM"
gene 1..7255
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="argonaute RISC catalytic subunit 1"
/db_xref="GeneID:236511"
/db_xref="MGI:MGI:2446630"
exon 1..187
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
CDS 163..2850
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="isoform 1x is encoded by transcript variant 1;
Piwi/Argonaute family protein meIF2C1; argonaute 1;
protein argonaute-1; mAgo1; eIF2C 1; eIF-2C 1; argonaute1;
eukaryotic translation initiation factor 2C, 1; argonaute
RISC catalytic component 1"
/codon_start=1
/transl_except=(pos:2734..2736,aa:OTHER)
/product="protein argonaute-1 isoform 1x"
/protein_id="NP_001304102.1"
/db_xref="GeneID:236511"
/db_xref="MGI:MGI:2446630"
/translation="
MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIKPDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGEGKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRNIDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQTVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGGRNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPPAGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPTRIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNERIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQILTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQALAKAVQVHQDTLRTMYFAXRQNAVTSLDRRKLSKPWELYHPNPEEARQREVGSEGV"
misc_feature 262..654
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="N-terminal domain of argonaute; Region: ArgoN;
pfam16486"
/db_xref="CDD:465134"
misc_feature 682..834
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="Argonaute linker 1 domain; Region: ArgoL1;
pfam08699"
/db_xref="CDD:462567"
misc_feature 835..1197
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
misc_feature order(991..993,1036..1038,1078..1080,1090..1092,
1144..1146,1165..1167,1171..1173)
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="nucleic acid-binding interface [nucleotide
binding]; other site"
/db_xref="CDD:239212"
misc_feature 1330..2607
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="PIWI domain, Argonaute-like subfamily. Argonaute is
the central component of the RNA-induced silencing complex
(RISC) and related complexes. The PIWI domain is the
C-terminal portion of Argonaute and consists of two
subdomains, one of which provides the...; Region:
Piwi_ago-like; cd04657"
/db_xref="CDD:240015"
misc_feature order(1741..1743,1753..1755,1789..1800,1807..1809,
1831..1833,1840..1842,1852..1854,1864..1866)
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="5' RNA guide strand anchoring site [active]"
/db_xref="CDD:240015"
misc_feature order(1945..1947,1951..1953,2161..2163,2575..2577)
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="active site"
/db_xref="CDD:240015"
exon 188..371
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 372..492
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 493..674
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 675..811
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 812..946
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 947..1034
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1035..1182
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1183..1302
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1303..1425
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1426..1559
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1560..1744
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1745..1904
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1905..1995
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 1996..2190
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 2191..2325
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 2326..2427
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 2428..2627
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
exon 2628..7227
/gene="Ago1"
/gene_synonym="Eif2c1"
/inference="alignment:Splign:2.1.0"
misc_feature 2734..2736
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="upstream translation termination codon, use of
which results in the shorter isoform 1"
regulatory 7197..7202
/regulatory_class="polyA_signal_sequence"
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="hexamer: TATAAA"
polyA_site 7227
/gene="Ago1"
/gene_synonym="Eif2c1"
/note="major polyA site"
ORIGIN
ggcggcaacggaggctgcgggggcgacagcgcgagcggccgggcttcgggggggagccgagcccggcccgggagcccgagcagtgcaagtgcgaggtacctaggcccctcacgctggactcctcagtctcccggccgcctgtcctccgcacgggtatatgggatggaagcgggaccctcgggagcagcggcaggtgcctacctgcctcccctgcagcaggtgtttcaggcaccccgccggcctggcattggcactgtgggcaaaccaatcaagcttctggccaattactttgaggtggacattcctaagattgacgtttaccattacgaggtggacatcaagccggataagtgtcctcgcagagtcaaccgggaggtggtggaatacatggtccagcatttcaaaccgcagatctttggggatcgcaagcctgtgtatgatggaaagaagaatatttacacggtcacagcactgcccattggcaatgagagggttgactttgaggtgacaatccccggggaggggaaggatagaatttttaaggtctccatcaagtggctagccattgtgagctggcgcatgctgcatgaagccttggtcagtggccagatccctgtgcccctggagtctgtgcaagccctggatgtggccatgaggcacctggcatctatgaggtacacccctgtgggccgctccttcttctcaccgcctgagggctactaccacccgctggggggtgggcgcgaggtctggttcggctttcaccagtctgtgcgccctgccatgtggaagatgatgctcaacattgatgtctcagccactgccttctacaaagcacagccagtgattgagttcatgtgtgaggtcctggacatcaggaacatagacgaacaacccaagcccctcacggattcccagcgtgttcggtttaccaaggagataaaaggcctgaaggtggaagtgacccactgtggacagatgaagaggaaataccgcgtgtgtaatgttacccgccgccctgctagccatcagacgttccccttgcagctggagagtggacagactgtggagtgcactgtggcacagtatttcaagcagaaatataaccttcagctcaagtatcctcacctgccctgcctacaagttgggcaagaacagaagcatacctatttgcccctcgaggtctgtaacattgtggctgggcagcggtgcattaagaagctgactgacaaccagacttcaaccatgataaaggctacagctaggtcggccccagacagacaggaggagatcagccgcctgatgaagaatgctagctacaacctggatccctacatccaggaatttggaatcaaagtgaaggatgacatgacggaggtgacaggacgtgtgctgccggcgcccatcttgcagtatggcggccggaaccgggccattgctacgcccaaccaaggtgtctgggacatgcgcgggaaacagttctacaatgggattgagatcaaagtctgggccatcgcctgcttcgcaccccagaaacagtgtcgagaagaggtgctcaagaacttcacagaccagcttcggaagatttccaaggatgcagggatgcccatccagggtcagccatgcttctgcaaatacgcacagggggcagacagcgtggagcccatgttccggcatctcaagaacacctactcaggactgcagctcattatcgtcatcctgcccgggaagacgccagtgtatgctgaagtgaaacgtgtcggagatacactcttgggaatggcaacacagtgtgtgcaggtgaagaatgtggtcaagacgtcaccgcagactctgtccaacctctgcctcaagatcaatgtcaaactcggtggcattaacaacatcctagtcccacaccagcgctctgctgtttttcaacagccagtgattttcctgggagcagatgttacacatcccccagctggggatgggaagaaaccatctatcacagcagtggtaggcagcatggacgcacaccccagccgatactgtgccaccgtgcgtgtgcagcgcccacggcaggagatcattgaagacttgtcctatatggtgcgcgagctgcttatccagttctacaagtccacccgcttcaagcccacccgcatcatcttctaccgcgacggcgtccccgagggccagctgccccagattcttcactatgagctgcttgccattcgagatgcatgcatcaaactggaaaaagactaccagcctgggatcacatatattgtggtgcagaagcgccatcacacccgcctgttctgtgctgacaagaatgagcggattgggaagagtggtaacatcccagcagggaccactgtggacaccaacatcacccacccatttgagttcgacttctatctgtgcagccatgcaggcatccagggtaccagccgaccatcccattattatgtcctttgggatgacaaccgtttcacagcagatgaactccagatcttgacataccagctgtgccacacttacgtacgatgcacacgttctgtctctatcccagcacctgcctactatgctcgcttggtggctttccgggcacgataccacctggtggacaaggaacatgacagtggagaggggagccacatatcagggcaaagcaatgggcgagacccccaggccctggccaaagctgtgcaggttcaccaggatactctacgcaccatgtacttcgcttgaaggcagaacgctgttacctcactggatagaagaaagctttccaagccctgggagctgtaccacccaaatccagaggaagcaaggcagagggaggtggggtcggaaggagtataggaggccttgtttctatctacagagggggtataagggtgggaagaggaccagcaagacagactaccagccagaaatcactgatagcaacctcattgtcctcaacccctctccccatcttgtcatatccgacccccttggaccaaaaggggcatcactagtacccaccatacacacagttgtctcatgtgactcacagtgctaaagactcatgctcaacagcctgctagggtcagctctgcagccctgtggtcaaatgctggtatgtttgggtttgctattctagatgagaaagtgggtgggaagagggcaggaatttttaggagccttaatcagaaaaggtctagatttgtttaagaaaaaggaaaacagactcagatcaatattttaggatactagatgttttcatgggttcagaatccactttgtaggaagatttttaatgctaatggtttgggttgctcctccccagctgccatcccctcccatcattcctctccacattctctaccccatgcaccttttccctgacagacatccagccctcgtaacacttaaggcactatggcacttagctctgaggtgacatgaccctgtcttccttccgcctgctggtgggtaaccagtgccttcccgcaacggtaatgctgcagaactgcaaccttttgtacctttctctgtggggtggggtgtgggtgggaaaggagggagggagggagggcagaaatagcccaatgccagcgagcctccagccagaatgccagctaattttcatttgaaggaattgacttccataatcattgagcttttaaaaaaaggtcacaacctcaagatggttaaaatccattgacatttgcactttcagacgtgacaagtctccgagctgctgagatgactggcccttggcctttcccctttagcttcctcttttccctggccccaccaccaccctgccagatctagagttactgtcatagtatttctcattcttggcttttttacccctgatggtaaagtctcgtttcaatatttcttaactggggtgtcttacagcagaagatcgtaaggactaaaataagaaaacaaaaaatctaaaggttatttttataccataacttgagtctattgccaaaatctggaaattccctcccatacctgatgagtctgcattccagaaacatggagccgtaagagggaactgtggaactgacttgtgttctggcctagctaagtagggggtggttgtctccccaaggtggggctcagcctctgtccttcctctgtgcagacaaagccttgttctcgagacagcctccctccagggcgctgtcctgccctcttccctgtaagtgcatcttccccttttctggactggactgtcctttgatccctgactaaccgagactctagcacgtcctctggacaggctggggaattttgctgctcccatttgcttctgtttacacaaatgaaattttcctgtttctcactagggcatgtgagtgggtggcatgggcttttctttttctacccctctcttgaggttctggggttcagctagctgtcttgcaggactggaaaagaagtgggttctagctttgtctttgctgaccttgaagcaaggccccctctttccttgaccattcttttttcttcctgcattattgcttgggatgggaaatttgaacctccgtgtacaggttccccttctgaggagcctgagcttaggattgccctactctggcgatgaagccatgatatgttagctctagcccaggcttagaggcccgctggagaaaggaagatctgaaccctggcctatggagtcaaaacctttccccaagagcccatgtatagacccagatttgctatgcaaatagtccagattcagttatggctggctacattattcagtaacttcccaacaggtagcacaaatattccttatggaaaaagcccaggactgttcagtagttcctcctgtacttttctgctggctacagtatggagtgccccatgggcacaggcccagccggagaacagaacggagggctctgggaagaggcagctcactggagagcctacattccttacacaagtgcctaaacagagtgatgccaacactccatctgccctgtccatcgccttcatagacagtctacttcgtgttccatcaccctttggggagggagctctttgcagacagtgtgttgtcaacttgggtacatttgggggcttggattaagggcactactccaggagggtccaatcattcaccagcatttgcagatgcccatagggaacaggtggctgtcacaactcccagcaacaagattttgttttctcctttttctttgcctcactctctccagttgggttttaagctagaatgaaaagcagtttcggtcctttggtatttatgtgccattcatgaaataaaagcaagagaatgctgggcacgatggcccatgtctgtaattctgttatctcagcactaaggctgaagcagaagatttgcaagttcagggtccacctgggctactcagtgaattccaggccagtgtgcactatgtagcaagaccatgtctccataaaaaagaccaagaaaaatgacttgggtgacagatcttgctgtgattttaaataattctttgagacttaactactgaccatgtgggttcttctcatttaaaggcagtatgcacacattacaaacagtgttgccaagcctcagcttgtttggatttggtttaagtggtgcattgtaccgagctctgggaggattccagcctcatcttagacagctctttctcctcccccaactccctcccatgcctccaccccacccccactgttcggctttccctttcctcttctggccttccctggcttccttttccttctccctcttccctcagcttgcttgctggctggcctgcctgcctgtctgcctgtgtgataatgaattctctgcatggctgcaatgatcccactgttagttggcaaggtcaggcttagctcattgactacagaagaccaaaatcctgtttctcatgcccagtggtgttagccctgggttgcactgtcctcaagcttacactaggtcagagcagcaggcctgtcaaactgacaaaactagtagggtttctggcaggttcaacacctctccattctgtggaggggcttggagaagaggcagtgaaggagaccgctgctttgaattcagtccagtgtgaccgattggttgaggtgctattggcagcctgttggggtcggcctggagctactgttactgggaacttaaacttggactttgactaaagttgaacagagtatgaaactgttctagaaatctagttctcaactgcgacatagctcctctgtgactgagcagcaaggctttccaacaggttccttttaaccagaattctatgaatgatgccggggacacagttttcttagctggcccatagaaggtctacaaggctgctaagtgttgtagacctggcatctggcatcacataggaggatggaatttcttccctttcaggatagaagagtcacctcttacctagccaaaaggcagttttgggaattcctgtcaggaggaaaggtttggttttgttttttaatttactgggctttagatggtagttcattatgccttccttgggcagggatcatggcagggatacgcaaggcactctaatactcggccttctaagcaggctgggaaagggggattctctggttttctctttctccccacttactaggacttgccttctccctgagccacgagagaggctgggttggtgctctccccttactctgctcctactgacttagaacctctggctgctgtatgatagcccaggaaagggaatggaaagaatgggctcaaaacaataatgtaaggaaggtggtttccttccttaaaaagggaaatcagaaactctccaagaattgtgtaagtaaagacaatgtgtctgaatgcactgagtcctctggtgtcatagcaataaggaaaaatgaattgactttctgtgcatacagtccagcctgactggtgtatgatgttgcacttagcagccatgtggtgggcatgtgtgactactctgggtttcactttattttctaaactttttattcctctcaagtccagcatggatggggaaatgtccctggagccccgcagctgtgtacttgtttgcatttgtttcccattgagacttgtgtttgtgtcctgctttgagctgtaccctgtcccgtccattgtgaaattatcccagcagctgtaatgtacagttcccttctcaagcaagcaacagcagcacaatcttgtgttttataaaaacaacagtggcttttatttctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]