2024-05-05 21:48:53, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001289587 683 bp mRNA linear ROD 19-DEC-2022 DEFINITION Mus musculus glycosylation dependent cell adhesion molecule 1 (Glycam1), transcript variant 1, mRNA. ACCESSION NM_001289587 VERSION NM_001289587.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 683) AUTHORS Dill-Garlow R, Chen KE and Walker AM. TITLE Sex Differences in Mouse Popliteal Lymph Nodes JOURNAL Sci Rep 9 (1), 965 (2019) PUBMED 30700819 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 683) AUTHORS Sundberg JP, Dadras SS, Silva KA, Kennedy VE, Garland G, Murray SA, Sundberg BA, Schofield PN and Pratt CH. TITLE Systematic screening for skin, hair, and nail abnormalities in a large-scale knockout mouse program JOURNAL PLoS One 12 (7), e0180682 (2017) PUBMED 28700664 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 683) AUTHORS Williams PA, Braine CE, Foxworth NE, Cochran KE and John SWM. TITLE GlyCAM1 negatively regulates monocyte entry into the optic nerve head and contributes to radiation-based protection in glaucoma JOURNAL J Neuroinflammation 14 (1), 93 (2017) PUBMED 28446179 REMARK GeneRIF: GlyCam1 levels modulate immune cell entry from the vasculature into neural tissues. Publication Status: Online-Only REFERENCE 4 (bases 1 to 683) AUTHORS Dickinson ME, Flenniken AM, Ji X, Teboul L, Wong MD, White JK, Meehan TF, Weninger WJ, Westerberg H, Adissu H, Baker CN, Bower L, Brown JM, Caddle LB, Chiani F, Clary D, Cleak J, Daly MJ, Denegre JM, Doe B, Dolan ME, Edie SM, Fuchs H, Gailus-Durner V, Galli A, Gambadoro A, Gallegos J, Guo S, Horner NR, Hsu CW, Johnson SJ, Kalaga S, Keith LC, Lanoue L, Lawson TN, Lek M, Mark M, Marschall S, Mason J, McElwee ML, Newbigging S, Nutter LM, Peterson KA, Ramirez-Solis R, Rowland DJ, Ryder E, Samocha KE, Seavitt JR, Selloum M, Szoke-Kovacs Z, Tamura M, Trainor AG, Tudose I, Wakana S, Warren J, Wendling O, West DB, Wong L, Yoshiki A, MacArthur DG, Tocchini-Valentini GP, Gao X, Flicek P, Bradley A, Skarnes WC, Justice MJ, Parkinson HE, Moore M, Wells S, Braun RE, Svenson KL, de Angelis MH, Herault Y, Mohun T, Mallon AM, Henkelman RM, Brown SD, Adams DJ, Lloyd KC, McKerlie C, Beaudet AL, Bucan M and Murray SA. CONSRTM International Mouse Phenotyping Consortium; Jackson Laboratory; Infrastructure Nationale PHENOMIN, Institut Clinique de la Souris (ICS); Charles River Laboratories; MRC Harwell; Toronto Centre for Phenogenomics; Wellcome Trust Sanger Institute; RIKEN BioResource Center TITLE High-throughput discovery of novel developmental phenotypes JOURNAL Nature 537 (7621), 508-514 (2016) PUBMED 27626380 REMARK Erratum:[Nature. 2017 Nov 16;551(7680):398. PMID: 29144450] REFERENCE 5 (bases 1 to 683) AUTHORS Koscielny G, Yaikhom G, Iyer V, Meehan TF, Morgan H, Atienza-Herrero J, Blake A, Chen CK, Easty R, Di Fenza A, Fiegel T, Grifiths M, Horne A, Karp NA, Kurbatova N, Mason JC, Matthews P, Oakley DJ, Qazi A, Regnart J, Retha A, Santos LA, Sneddon DJ, Warren J, Westerberg H, Wilson RJ, Melvin DG, Smedley D, Brown SD, Flicek P, Skarnes WC, Mallon AM and Parkinson H. TITLE The International Mouse Phenotyping Consortium Web Portal, a unified point of access for knockout mice and related phenotyping data JOURNAL Nucleic Acids Res 42 (Database issue), D802-D809 (2014) PUBMED 24194600 REFERENCE 6 (bases 1 to 683) AUTHORS Hemmerich S, Leffler H and Rosen SD. TITLE Structure of the O-glycans in GlyCAM-1, an endothelial-derived ligand for L-selectin JOURNAL J Biol Chem 270 (20), 12035-12047 (1995) PUBMED 7538131 REFERENCE 7 (bases 1 to 683) AUTHORS Hemmerich S, Bertozzi CR, Leffler H and Rosen SD. TITLE Identification of the sulfated monosaccharides of GlyCAM-1, an endothelial-derived ligand for L-selectin JOURNAL Biochemistry 33 (16), 4820-4829 (1994) PUBMED 7512827 REFERENCE 8 (bases 1 to 683) AUTHORS Lasky LA, Singer MS, Dowbenko D, Imai Y, Henzel WJ, Grimley C, Fennie C, Gillett N, Watson SR and Rosen SD. TITLE An endothelial ligand for L-selectin is a novel mucin-like molecule JOURNAL Cell 69 (6), 927-938 (1992) PUBMED 1376638 REFERENCE 9 (bases 1 to 683) AUTHORS Kawamura,K., Satow,H., Do Ik,L., Sakai,S., Takada,S. and Obinata,M. TITLE Modulation of the transferred mouse 26K casein gene in mouse L cells by glucocorticoid hormone JOURNAL J Biochem 101 (1), 103-110 (1987) PUBMED 3571195 REFERENCE 10 (bases 1 to 683) AUTHORS Satow,H., Sakai,S. and Obinata,M. TITLE Post-transcriptional control of 26 k casein genes during lactogenesis in mouse mammary glands JOURNAL J Biochem 99 (6), 1639-1643 (1986) PUBMED 3745138 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AC108858.16 and BE947771.1. Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AW212743.1, BF122403.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849375 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-114 AC108858.16 93487-93600 115-159 AC108858.16 94327-94371 160-413 AC108858.16 95110-95363 414-502 AC108858.16 95554-95642 503-683 BE947771.1 1-181 c FEATURES Location/Qualifiers source 1..683 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="15" /map="15 59.03 cM" gene 1..683 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="glycosylation dependent cell adhesion molecule 1" /db_xref="GeneID:14663" /db_xref="MGI:MGI:95759" exon 1..114 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" misc_feature 30..32 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="upstream in-frame stop codon" CDS 51..437 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="isoform 1 precursor is encoded by transcript variant 1; sulfated 50 kDa glycoprotein; endothelial ligand FOR L-selectin; Sele ligand; GlyCAM 1; Glycosylation-dependent cell adhesion molecule 1" /codon_start=1 /product="glycosylation-dependent cell adhesion molecule 1 isoform 1 precursor" /protein_id="NP_001276516.1" /db_xref="CCDS:CCDS88862.1" /db_xref="GeneID:14663" /db_xref="MGI:MGI:95759" /translation="
MKFFTVLLFVSLAATSLALLPGSKDELQMKTQPTDAIPAAQSTPTSYTSEESTSSKDLSKEPSIFREELISKDNVVIESTKPENQEAQDGLRSGSSQLEETTRPTTSAGMSQGRRKMSWEVQPPQRKI"
sig_peptide 51..107 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="/evidence=ECO:0000269|PubMed:1376638; propagated from UniProtKB/Swiss-Prot (Q02596.1)" misc_feature 108..>374 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Glycosylation-dependent cell adhesion molecule 1 (GlyCAM-1); Region: GLYCAM-1; pfam05242" /db_xref="CDD:368355" misc_feature 210..212 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 225..227 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 237..239 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" misc_feature 261..263 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /note="Phosphoserine. /evidence=ECO:0000250|UniProtKB:P80195; propagated from UniProtKB/Swiss-Prot (Q02596.1); phosphorylation site" exon 115..159 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" exon 160..413 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" exon 414..669 /gene="Glycam1" /gene_synonym="glyCAM-1; MC26; Sgp50" /inference="alignment:Splign:2.1.0" ORIGIN
agcattctactctgcttcccagggaaagctgaccttgttccagtgccaccatgaaattcttcactgtcctgctatttgtcagtcttgctgccacctctcttgctctcctgcctgggtccaaagatgaacttcaaatgaagactcagcccacagatgccattccagctgcccagtccactcccaccagctacaccagtgaggagagtacttccagtaaggacctttccaaggagccttccatcttcagagaagagctgatttccaaagataatgtggtgatagaatctaccaagccagagaatcaagaggcccaggatgggctcaggagcgggtcatctcagctggaagagaccacaagacccaccacctcagctggtatgagccagggaagaaggaagatgtcttgggaggtgcaaccacctcagaggaaaatctgaccaagtcaagccagacagtggaggaagaactgggtaaaataattgaaggatttgtaactggtgcagaagacataatctctggtgccagtcgtatcacgaagtcatgaagacaaaaacacctaaccactaagtcccatgctaggtggtgccttcatcagccacattctgctcatctgaccaccacctctcagtctgccctttgatgtcttacattaaagtattgcaacctaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]