LOCUS       NM_001270791             950 bp    mRNA    linear   ROD 06-AUG-2023
DEFINITION  Mus musculus IBA57 homolog, iron-sulfur cluster assembly (Iba57),
            transcript variant 2, mRNA; nuclear gene for mitochondrial product.
ACCESSION   NM_001270791 XM_003688885
VERSION     NM_001270791.1
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 950)
  AUTHORS   Waller JC, Alvarez S, Naponelli V, Lara-Nunez A, Blaby IK, Da Silva
            V, Ziemak MJ, Vickers TJ, Beverley SM, Edison AS, Rocca JR, Gregory
            JF 3rd, de Crecy-Lagard V and Hanson AD.
  TITLE     A role for tetrahydrofolates in the metabolism of iron-sulfur
            clusters in all domains of life
  JOURNAL   Proc Natl Acad Sci U S A 107 (23), 10412-10417 (2010)
   PUBMED   20489182
  REMARK    GeneRIF: Mouse COG0354 represents an ancient, folate-dependent
            protein family involved in the metabolism of Fe/S cluster
            containing enzymes
REFERENCE   2  (bases 1 to 950)
  AUTHORS   Nilsson R, Schultz IJ, Pierce EL, Soltis KA, Naranuntarat A, Ward
            DM, Baughman JM, Paradkar PN, Kingsley PD, Culotta VC, Kaplan J,
            Palis J, Paw BH and Mootha VK.
  TITLE     Discovery of genes essential for heme biosynthesis through
            large-scale gene expression analysis
  JOURNAL   Cell Metab 10 (2), 119-130 (2009)
   PUBMED   19656490
  REMARK    GeneRIF: Required for functional heme biosynthesis in erythroid
            cells.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL645854.10, BM935743.1 and AW488265.1.
            
            On Aug 2, 2012 this sequence version replaced XM_003688885.1.
            
            Transcript Variant: This variant (2) contains alternate 3' exon
            structure and it thus differs in the 3' coding region and 3' UTR,
            compared to variant 1. The encoded isoform (2) has a distinct
            C-terminus and is shorter than isoform 1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BM935743.1, SRR7345562.1698026.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164131, SAMN01164132
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-98                AL645854.10        146991-147088       c
            99-673              BM935743.1         54-628
            674-950             AW488265.1         1-277               c
FEATURES             Location/Qualifiers
     source          1..950
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="11"
                     /map="11 36.97 cM"
     gene            1..950
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="IBA57 homolog, iron-sulfur cluster assembly"
                     /db_xref="GeneID:216792"
                     /db_xref="MGI:MGI:3041174"
     exon            1..395
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /inference="alignment:Splign:2.1.0"
     CDS             55..759
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; putative transferase C1orf69 homolog,
                     mitochondrial; putative transferase CAF17 homolog,
                     mitochondrial; iron-sulfur cluster assembly factor
                     homolog; IBA57, iron-sulfur cluster assembly homolog"
                     /codon_start=1
                     /product="putative transferase CAF17 homolog,
                     mitochondrial isoform 2 precursor"
                     /protein_id="NP_001257720.1"
                     /db_xref="GeneID:216792"
                     /db_xref="MGI:MGI:3041174"
                     /translation="

MAAVALLRGAAVGRRSPAWHWRLSGTASHCLARGFGLLGSNPADGVAWTCFRLDGRALVRVRGPDAAPFLLGLSTNELPLSGPPTGAAQPSARAAYAHFLNVQGRTLYDVILYGLLLNCSAVASAVRQLAGLPSLQLWLVNCSAAAATTAVPPPLLTSAVSAASFCYQPSPHYRKQEKKMERSLFSGLLLPHWGKAQESLPTTSLSEPSQPVCIAPERMFGPITDLPIGNLRND"

     misc_feature    211..>426
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /note="Folate-binding Fe-S cluster repair protein YgfZ,
                     possible role in tRNA modification [Posttranslational
                     modification, protein turnover, chaperones]; Region: YgfZ;
                     COG0354"
                     /db_xref="CDD:223431"
     exon            396..935
                     /gene="Iba57"
                     /gene_synonym="4930543L23Rik; A230051G13Rik; C1orf69"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gccgccgccgccgcccggggccgctgtggtgcccgccttcacttagcgcccaagatggcagcggtggcgctgcttcggggcgcggctgtggggcgcagaagcccagcttggcactggcggctgagcgggaccgcgagtcactgcctagcccgtggctttggccttcttggcagcaaccccgcggacggtgtggcctggacttgcttccggctggacgggcgcgccttagtgcgcgtgcgcggcccggacgctgcacccttcctgttgggactatcgaccaatgagctgccgctttcggggcctccgaccggcgcggctcagccctctgcgcgtgcggcgtatgcccatttcctgaatgtgcagggacgcacgctctatgacgtcattctgtatgggctgttgttgaactgctcagctgtcgcttcagctgtcagacagctggcaggcttgccttccctgcagctttggcttgtcaactgctcagctgctgccgccaccactgcagttccaccgcctctgctgacctctgctgtctctgctgcttctttctgttaccagcccagcccacactacagaaagcaagaaaagaaaatggagagaagccttttctcgggcctgctgctcccacactggggcaaagctcaggaaagtcttcccacaacctcactaagtgagccttcacagcctgtttgtatcgccccagaaaggatgtttggaccaatcacagacttgcctatcggcaaccttcgtaatgactgaggattgtgttttggacagccataacgctgcatctttagcaatagttacagcagatcctcttctaggctaccagggagctgctgtccatttggccaaattgaaagtggttgcaagatcatctagaattcagtgagacctgtaatggcaaaatgtctgataaaaaccattttaaacaaaaaaaaaaaaaaaaa

//