LOCUS       NM_001252577            1254 bp    mRNA    linear   ROD 01-MAY-2025
DEFINITION  Mus musculus killer cell lectin-like receptor, subfamily A, member
            4 (Klra4), transcript variant 2, mRNA.
ACCESSION   NM_001252577 NM_001039118
VERSION     NM_001252577.2
KEYWORDS    RefSeq.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 1254)
  AUTHORS   Nabekura,T. and Lanier,L.L.
  TITLE     Activating Receptors for Self-MHC Class I Enhance Effector
            Functions and Memory Differentiation of NK Cells during Mouse
            Cytomegalovirus Infection
  JOURNAL   Immunity 45 (1), 74-82 (2016)
   PUBMED   27438766
  REMARK    GeneRIF: this study shows that after mouse cytomegalovirus
            infection, Ly49D augmented IFN-gamma production by virus-specific
            Ly49H(+) NK cells and preferentially promoted the generation of
            memory Ly49H(+) NK cells
REFERENCE   2  (bases 1 to 1254)
  AUTHORS   Liu,J., Liu,S., Xia,M., Xu,S., Wang,C., Bao,Y., Jiang,M., Wu,Y.,
            Xu,T. and Cao,X.
  TITLE     Rhomboid domain-containing protein 3 is a negative regulator of
            TLR3-triggered natural killer cell activation
  JOURNAL   Proc Natl Acad Sci U S A 110 (19), 7814-7819 (2013)
   PUBMED   23610400
REFERENCE   3  (bases 1 to 1254)
  AUTHORS   Schenkel,A.R., Kingry,L.C. and Slayden,R.A.
  TITLE     The ly49 gene family. A brief guide to the nomenclature, genetics,
            and role in intracellular infection
  JOURNAL   Front Immunol 4, 90 (2013)
   PUBMED   23596445
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1254)
  AUTHORS   Tassi,I., Le Friec,G., Gilfillan,S., Takai,T., Yokoyama,W.M. and
            Colonna,M.
  TITLE     DAP10 associates with Ly49 receptors but contributes minimally to
            their expression and function in vivo
  JOURNAL   Eur J Immunol 39 (4), 1129-1135 (2009)
   PUBMED   19247984
  REMARK    GeneRIF: these data demonstrate that DAP10 does associate with
            Ly49H and Ly49D in primary NK cells.
REFERENCE   5  (bases 1 to 1254)
  AUTHORS   Merck,E., Voyle,R.B. and MacDonald,H.R.
  TITLE     Ly49D engagement on T lymphocytes induces TCR-independent
            activation and CD8 effector functions that control tumor growth
  JOURNAL   J Immunol 182 (1), 183-192 (2009)
   PUBMED   19109149
  REMARK    GeneRIF: Ly49D stimulation triggers cellular activation of CD4 and
            CD8 populations; Ly49D recognizes the classical hamster class I
            molecule Hm1-C4 on CHO cells, as demonstrated by the killing of
            Hm1-C4-transfected thymoma cells by Ly49D cytotoxic T cells.
REFERENCE   6  (bases 1 to 1254)
  AUTHORS   Yokoyama,W.M.
  TITLE     Hybrid resistance and the Ly-49 family of natural killer cell
            receptors
  JOURNAL   J Exp Med 182 (2), 273-277 (1995)
   PUBMED   7629493
  REMARK    Review article
REFERENCE   7  (bases 1 to 1254)
  AUTHORS   Smith,H.R., Karlhofer,F.M. and Yokoyama,W.M.
  TITLE     Ly-49 multigene family expressed by IL-2-activated NK cells
  JOURNAL   J Immunol 153 (3), 1068-1079 (1994)
   PUBMED   8027540
REFERENCE   8  (bases 1 to 1254)
  AUTHORS   Morse,H.C. 3rd.
  TITLE     Genetic nomenclature for loci controlling surface antigens of mouse
            hemopoietic cells
  JOURNAL   J Immunol 149 (10), 3129-3134 (1992)
   PUBMED   1431091
  REMARK    Review article
            Erratum:[J Immunol 1993 Mar 15;150(6):2563]
REFERENCE   9  (bases 1 to 1254)
  AUTHORS   Wong,S., Freeman,J.D., Kelleher,C., Mager,D. and Takei,F.
  TITLE     Ly-49 multigene family. New members of a superfamily of type II
            membrane proteins with lectin-like domains
  JOURNAL   J Immunol 147 (4), 1417-1423 (1991)
   PUBMED   1869832
REFERENCE   10 (bases 1 to 1254)
  AUTHORS   Yokoyama,W.M., Kehn,P.J., Cohen,D.I. and Shevach,E.M.
  TITLE     Chromosomal location of the Ly-49 (A1, YE1/48) multigene family.
            Genetic association with the NK 1.1 antigen
  JOURNAL   J Immunol 145 (7), 2353-2358 (1990)
   PUBMED   1975828
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC090127.11 and AC090563.17.
            
            On Sep 7, 2022 this sequence version replaced NM_001252577.1.
            
            Transcript Variant: This variant (2) differs in the 5' UTR and uses
            an alternate in-frame splice site in the coding region, compared to
            variant 1. This results in a longer protein (isoform 2), compared
            to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK080171.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMN00849375,
                                           SAMN00849381 [ECO:0006172]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-101               AC090127.11        159091-159191
            102-265             AC090127.11        161016-161179
            266-355             AC090127.11        163175-163264
            356-562             AC090127.11        164145-164351
            563-705             AC090127.11        166705-166847
            706-809             AC090563.17        199734-199837       c
            810-1254            AC090563.17        190499-190943       c
FEATURES             Location/Qualifiers
     source          1..1254
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="6"
                     /map="6 63.44 cM"
     gene            1..1254
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="killer cell lectin-like receptor, subfamily A,
                     member 4"
                     /db_xref="GeneID:16635"
                     /db_xref="MGI:MGI:101904"
     exon            1..101
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     exon            102..265
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     CDS             154..945
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="isoform 2 is encoded by transcript variant 2;
                     killer cell lectin-like receptor 4; killer cell
                     lectin-like receptor subfamily A member 32; lymphocyte
                     antigen 49d; T-cell surface glycoprotein Ly-49D; killer
                     cell lectin-like receptor subfamily A member 33"
                     /codon_start=1
                     /product="killer cell lectin-like receptor 4 isoform 2"
                     /protein_id="NP_001239506.1"
                     /db_xref="CCDS:CCDS57457.1"
                     /db_xref="GeneID:16635"
                     /db_xref="MGI:MGI:101904"
                     /translation="

MTEQEDTFSAVRFHKSSGLQNEMRLKETRKPEKARLRVCSVPWQLIVIALGILISLRLVTVAVLMTNIFQYGQQKHELKEFLKHHNNCSIMQSDINLKDELLKNKSIECNLLESLNRDQNILCDKTRTVLDYLQHTGRGVKVYWFCYGMKCYYFVMDRKPWSRCKQSCQNSSLTLLKIDDEDELKFLQLVVPSDSCWIGLSYDNKKKDWAWIDNRPSKLALNTTKYNIRDGGCMFLSKTRLDNNYCDQSFICICGKRLDKFPH"

     misc_feature    271..615
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="Ly49-like protein, N-terminal region; Region: Ly49;
                     pfam08391"
                     /db_xref="CDD:462461"
     misc_feature    286..348
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="propagated from UniProtKB/Swiss-Prot (Q60651.2);
                     transmembrane region"
     misc_feature    412..414
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
     misc_feature    463..465
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
     misc_feature    580..921
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="C-type lectin-like domain (CTLD) of the type found
                     in natural killer cell receptors (NKRs); Region:
                     CLECT_NK_receptors_like; cd03593"
                     /db_xref="CDD:153063"
     misc_feature    661..663
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
     misc_feature    order(736..738,817..819,871..873,877..882)
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153063"
     misc_feature    817..819
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q60651.2); glycosylation site"
     exon            266..355
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     exon            356..562
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     exon            563..705
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     exon            706..809
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     exon            810..1254
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1234..1239
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="hexamer: AATAAA"
     polyA_site      1254
                     /gene="Klra4"
                     /gene_synonym="Chok; Klra32; Klra33; Ly-49d; Ly49d;
                     ly49r<129>"
                     /note="major polyA site"
ORIGIN      

agttctgcctttcttcttggagcctctaaggggatacacaccagaaaaggcccacattaccccaacagggacatccattccttctacccacctcacttcagaaatcactcaaggacatattttaaaagagaacatactctacatactcccaagatgactgaacaggaagacactttctcagctgtgagattccataagtcttcagggttgcagaacgagatgaggctcaaggagacacggaagcctgaaaaagctcgcctcagagtgtgttcagttccctggcagctcattgtgatagctctcgggatcctcatttcccttcgactggtaactgttgcagtgcttatgacaaacatttttcagtatggtcaacaaaaacatgaactgaaggaatttctaaaacaccacaataactgcagcatcatgcaaagtgacatcaacttgaaggatgaactgctgaaaaataagtctatagagtgtaatcttctggaatccctcaacagggatcaaaacatactgtgtgataaaaccaggactgttttagattacttacagcacacaggcagaggtgttaaagtatactggttctgttatggtatgaaatgttattatttcgtcatggacagaaaaccatggagtagatgtaaacagagctgccagaattccagcttaacccttctgaagatagatgatgaggatgaactgaagttccttcagctcgtggttccttcagacagttgctggattggattgtcatatgataataagaaaaaagattgggcatggattgacaatcgcccatctaaacttgccttgaacacaacgaaatacaatataagagatggaggatgtatgttcttatctaaaactagactagacaataattactgtgatcaatcattcatctgtatttgtgggaagagattggacaaattccctcattgactctccagtgagtgttaaaagtaaaaaaaaaaaaaaatgaaaatttctgactctcatttgtttcctgtaataattcatgactccttagaaacaagtgcttgaccattggacatagtctgcagtgcaaagagagagacaatctggaagattttgggaatgttctctgaaacatgacatgaaagagcagaggatatcttccttccctgtggagactggacagatcttctctggtcccgcaaaacttgaatgaatctgatttatttgtttgcataaactccaatagaattaaataaaggatcttaataacca

//