LOCUS       NM_001145406             590 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 3G (Rhox3g), mRNA.
ACCESSION   NM_001145406 NR_033696 XM_976278
VERSION     NM_001145406.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 590)
  AUTHORS   Maclean JA, Bettegowda A, Kim BJ, Lou CH, Yang SM, Bhardwaj A,
            Shanker S, Hu Z, Fan Y, Eckardt S, McLaughlin KJ, Skoultchi AI and
            Wilkinson MF.
  TITLE     The rhox homeobox gene cluster is imprinted and selectively
            targeted for regulation by histone h1 and DNA methylation
  JOURNAL   Mol Cell Biol 31 (6), 1275-1287 (2011)
   PUBMED   21245380
REFERENCE   2  (bases 1 to 590)
  AUTHORS   MacLean JA 2nd and Wilkinson MF.
  TITLE     The Rhox genes
  JOURNAL   Reproduction 140 (2), 195-213 (2010)
   PUBMED   20430877
  REMARK    Review article
REFERENCE   3  (bases 1 to 590)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   4  (bases 1 to 590)
  AUTHORS   Hu Z, Shanker S, MacLean JA 2nd, Ackerman SL and Wilkinson MF.
  TITLE     The RHOX5 homeodomain protein mediates transcriptional repression
            of the netrin-1 receptor gene Unc5c
  JOURNAL   J Biol Chem 283 (7), 3866-3876 (2008)
   PUBMED   18077458
REFERENCE   5  (bases 1 to 590)
  AUTHORS   Jackson M, Watt AJ, Gautier P, Gilchrist D, Driehaus J, Graham GJ,
            Keebler J, Prugnolle F, Awadalla P and Forrester LM.
  TITLE     A murine specific expansion of the Rhox cluster involved in
            embryonic stem cell biology is under natural selection
  JOURNAL   BMC Genomics 7, 212 (2006)
   PUBMED   16916441
  REMARK    Publication Status: Online-Only
REFERENCE   6  (bases 1 to 590)
  AUTHORS   Wang X and Zhang J.
  TITLE     Remarkable expansions of an X-linked reproductive homeobox gene
            cluster in rodent evolution
  JOURNAL   Genomics 88 (1), 34-43 (2006)
   PUBMED   16574372
REFERENCE   7  (bases 1 to 590)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   8  (bases 1 to 590)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   9  (bases 1 to 590)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC147475.1.
            
            On Dec 21, 2012 this sequence version replaced NM_001145406.2.
            
            Summary: This gene is a member of the reproductive homeobox
            X-linked family (Rhox), which forms part of the superfamily of
            Homeobox transcription factors. Rhox family members are thought to
            contribute to early embryo development as well as female and male
            gametogenesis because they are expressed during embryogenesis and
            in reproductive tissues. In the mouse, this family expanded to form
            gene clusters categorized into alpha, beta and gamma, depending on
            chromosomal locations. Rhox3 paralogs are in the alpha cluster and
            are reported to be more highly expressed in testes compared to
            ovaries. This protein is missing a portion of the N-terminus
            compared to other Rhox3 paralogs, so its functional capacity is
            unclear. [provided by RefSeq, Dec 2012].
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC147475.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849384, SAMN01766820
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-590               BC147475.1         1-590
FEATURES             Location/Qualifiers
     source          1..590
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.93 cM"
     gene            1..590
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /note="reproductive homeobox 3G"
                     /db_xref="GeneID:546294"
                     /db_xref="MGI:MGI:3770313"
     exon            1..51
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /inference="alignment:Splign:2.1.0"
     CDS             36..518
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /note="reproductive homeobox 3F; reproductive homeobox 3G,
                     pseudogene"
                     /codon_start=1
                     /product="reproductive homeobox 3G"
                     /protein_id="NP_001138878.1"
                     /db_xref="CCDS:CCDS72366.1"
                     /db_xref="GeneID:546294"
                     /db_xref="MGI:MGI:3770313"
                     /translation="

MDSTQGTKVLPAEEGRNEEDGGQVESALGATAARGRGKEALNGESPAAAGTAGLVEEDRNKEDGGTKGGEKNEQEVREQIPEHVEGESDQAEAPRQVPRRRLHHRFTQWQLDELERIFRMNYFLSLEARKQLARWMGVNEAIVKRWFQKRREQYRWYKRL"

     misc_feature    333..503
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(333..347,351..353,402..404,420..422,459..461,
                     465..470,477..482,486..494,498..503)
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(339..341,348..350,468..470,477..482,489..491)
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            52..421
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /inference="alignment:Splign:2.1.0"
     exon            422..467
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /inference="alignment:Splign:2.1.0"
     exon            468..590
                     /gene="Rhox3g"
                     /gene_synonym="Rhox3.7; Rhox3f; Rhox3g-ps"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gagcttcaaggtcagtcaacggatgtgagactaaaatggacagcacccaaggtaccaaggttttgccggctgaagagggaagaaatgaggaagatggaggacaggtggagtcggcattgggagccacagccgcaaggggtagaggaaaagaagcattaaatggagagagtcccgccgctgctggcactgcaggccttgtagaggaagacaggaacaaggaagatggtggcaccaagggaggtgagaagaatgagcaggaagtgagggagcagattcctgagcatgttgaaggagagagtgaccaggctgaagcgccaaggcaggtgccacgacgtcgattgcaccatagattcacccagtggcagctggacgaactggagagaattttccggatgaattattttctcagtctagaagcaagaaaacaactggcccgatggatgggtgtgaatgaagccatagtgaagagatggtttcagaagaggagagaacaatacaggtggtataagaggctataaggtctcagaggttctcctcctgcttctcagaacatctttcatgaagactgtggaggaaccctgcagtgcaaa

//