LOCUS       NM_001039688             891 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 4A (Rhox4a), mRNA.
ACCESSION   NM_001039688 XM_975797 XM_975830
VERSION     NM_001039688.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 891)
  AUTHORS   Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ,
            Harley VR, Koopman P and Sinclair AH.
  TITLE     The rhox homeobox gene family shows sexually dimorphic and dynamic
            expression during mouse embryonic gonad development
  JOURNAL   Biol Reprod 79 (3), 468-474 (2008)
   PUBMED   18562707
REFERENCE   2  (bases 1 to 891)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   3  (bases 1 to 891)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   4  (bases 1 to 891)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AJ972665.1.
            
            On May 28, 2010 this sequence version replaced NM_001039688.2.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ972665.1, BC057925.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN00849383, SAMN01164134
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on expression, longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..891
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.69 cM"
     gene            1..891
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /note="reproductive homeobox 4A"
                     /db_xref="GeneID:664609"
                     /db_xref="MGI:MGI:3580240"
     exon            1..203
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    74..76
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /note="upstream in-frame stop codon"
     CDS             137..754
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /codon_start=1
                     /product="reproductive homeobox 4A"
                     /protein_id="NP_001034777.1"
                     /db_xref="CCDS:CCDS40930.1"
                     /db_xref="GeneID:664609"
                     /db_xref="MGI:MGI:3580240"
                     /translation="

MEHQNTNYLLHEGLGKDKENLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVKRWFKKRREHFRRGQSQLGMNDDASVGSHSTFL"

     misc_feature    521..697
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(521..535,539..541,590..592,608..610,647..649,
                     653..658,665..670,674..682,686..691)
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(527..529,536..538,656..658,665..670,677..679)
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            204..609
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /inference="alignment:Splign:2.1.0"
     exon            610..655
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /inference="alignment:Splign:2.1.0"
     exon            656..891
                     /gene="Rhox4a"
                     /gene_synonym="Rhox4; Rhox4.1"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ctttcggctttcggctttcggctttcggctttcggctgtcagctttcggctgtcggctttcagctttcggttttgacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaatttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcaaggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttaagagatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgacgcctctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg

//