ver.2
Help
|
Advanced search
|
Japanese
Previous release (v1)
2024-05-21 03:48:27, GGRNA : RefSeq release 222 (Jan, 2024)
Summary:
Results:
Matches are highlighted with green background.
Overlapping matches are dark colored.
Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /codon_start=1 /product="claudin domain-containing protein 1 isoform X1" /protein_id="XP_011244188.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <627..809 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_...
Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BY110541.1, AK005088.1 and BB798247.1. On Aug 10, 2010 this sequence version replaced NM_008770.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining...
misc_feature 257..319 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 293..946 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 368..370 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
misc_feature 272..334 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); transmembrane region" misc_feature 308..961 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 383..385 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000269|PubMed:19349973; propagated from UniProtKB/Swiss-Prot (Q9CQX5.1); glycosylation site" misc_feature...
protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 2" /protein_id="NP_001239379.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGLCACICRSLYPTLATGILHLLAGLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature 286..939 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region...
variant 3; claudin domain-containing protein 1; claudin 25" /codon_start=1 /product="claudin domain-containing protein 1 isoform 3" /protein_id="NP_001239380.1" /db_xref="GeneID:224250" /db_xref="MGI:MGI:2447860" /translation="MGGDRLENKTSVSVASWSSLNARMDNRFATAFVIACVLSLISTIYMAASIGTDFWYEYRSPIQENSSDSNKIAWEDFLGDEADEKTYNDVLFRYNGSLGLWRRCITIPKNTHWYAPPERTESFDVVTKCMSFTLNEQFMEKYVDPGNHNSGIDLLRTCLCTLGSVSCYVAGIELLHQKVELPKDVSGEFGWSFCLACVSAPLQFMAAALFIWAAHTNRKEYTLMKAYRVA" misc_feature <616..798 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
claudin 16 (Cldn16), mRNA. ACCESSION NM_053241 VERSION NM_053241.5 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK085268.1 and AK085333.1. On Aug 11, 2010 this sequence version replaced NM_053241.4. Summary: This gene encodes a member of the claudin family. Claudins...
08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..734 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 735..2143 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2143) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain...
exon 176..485 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 486..596 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" exon 597..2005 /gene="Cldnd1" /gene_synonym="1110019C08Rik; claudin-25; Cldn25" /inference="alignment:Splign:2.1.0" ORIGIN // REFERENCE 1 (bases 1 to 2005) AUTHORS Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A and Inoue A. TITLE Claudin domain containing 1 contributing to endothelial cell adhesion...
db_xref="MGI:MGI:1860425" CDS 432..1151 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_036015927.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 498..974 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 199..963 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528551.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 211..741 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 361..1125 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528552.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 373..903 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 388..1152 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528550.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 400..930 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
db_xref="MGI:MGI:1276110" CDS 402..1166 /gene="Cldn2" /codon_start=1 /product="claudin-2 isoform X1" /protein_id="XP_006528549.1" /db_xref="GeneID:12738" /db_xref="MGI:MGI:1276110" /translation="MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPRSAQQPKAKSEFNSYSLTGEAALPDTLDLMEDQPIRVYVSALQSL" misc_feature 414..944 /gene="Cldn2" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
CDS 157..702 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X3" /protein_id="XP_030098889.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPVVRRLIGRCCGAQAQRQIRGGVCDYLD" misc_feature 223..576 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
db_xref="MGI:MGI:1860425" CDS 229..948 /gene="Cldn14" /codon_start=1 /product="claudin-14 isoform X1" /protein_id="XP_006523130.1" /db_xref="GeneID:56173" /db_xref="MGI:MGI:1860425" /translation="MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV" misc_feature 295..771 /gene="Cldn14" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
CDS 155..661 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X4" /protein_id="XP_030098890.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPLCDG" misc_feature 221..586 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
CDS 261..764 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X5" /protein_id="XP_030098891.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGFCFLLADMILQSTEAISGFPVCL" misc_feature 327..692 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
CDS 120..749 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /codon_start=1 /product="claudin 34B2 isoform X1" /protein_id="XP_011246174.1" /db_xref="GeneID:73347" /db_xref="MGI:MGI:1920597" /translation="MPLKKCHGQMGGFALTTVAWLLCCISTGLPQWQVWHYEDPVVLKPTVALVGMWRACVFHTDRNSSNTRVCYQYNYDGSIPLYIRGNQHLLLVSSFLGLFGKITTIIALSNVHMGRVRRNATCNPFRLSGILNIIASSFLYLAVLFNYIAIMSKWGIAFPPSFNLPFQPDTRKMGSAMALAIIAAVFFLLSGTICLSSNLNIDKTPRSKM" misc_feature 171..707 /gene="Cldn34b2" /gene_synonym="1700042B14Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
gene="Cldn34b4" /gene_synonym="4930428D18Rik" /codon_start=1 /product="claudin 34B4 isoform X1" /protein_id="XP_006528276.1" /db_xref="GeneID:619294" /db_xref="MGI:MGI:3588232" /translation="MLIKNRCNSQMGGFALTTVAWLICCISIGLPQWRVWHFQDPVVFKSTTAFVGMWRVCTLQYDEDFRNMRICHQYNYHDTFLPLNIRMIQQLLLVSSFFGLVGKVTTIIALWNVCQGRVHRKATYNPFGLSGILNIISSSFICLAILINYVSIIFQEGIIFPPSFNIPSQPDTQEIGSAMALAFIAAVLFLLSGTILLTSNFPVDKPVCSKY" misc_feature 343..882 /gene="Cldn34b4" /gene_synonym="4930428D18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X1" /protein_id="XP_017167838.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLLLSACRHDLAEHRSHQRIPGMPMNAACLGQNKGMAFSLAPACFSAERRDRSLETTETRIKWLVES" misc_feature 224..577 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
gene="Cldnd2" /gene_synonym="1700071E18Rik" /codon_start=1 /product="claudin domain-containing protein 2 isoform X2" /protein_id="XP_030098888.1" /db_xref="GeneID:74276" /db_xref="MGI:MGI:1921526" /translation="MGVKKSLQTGGNLLNLLSSILTVLSTTTNYWTRQQGGHSGLWQECTHGKCSNIPCQNTVAVSAACMVLAATFSIVALGIGIRIQCREAESRRSQNTIVLLFLSGLLLLIALAVYTSKNAWKPEVFFSWSYFFGWLALPFLFIAGNQHEGKRVETTPLEDSPPQKLPSHLFFLAKSTITSSDFPAPALQDTRWKRPWNPHP" misc_feature 242..607 /gene="Cldnd2" /gene_synonym="1700071E18Rik" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2 isoform X1" /protein_id="XP_006528492.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" misc_feature 375..872 /gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /codon_start=1 /product="claudin 34C2 isoform X1" /protein_id="XP_006528491.1" /db_xref="GeneID:625591" /db_xref="MGI:MGI:3644765" /translation="MVLLNKSANHQIRGFTLATIACIMCNTSMALPEWRICYLNNSMLSYPSLAFVNIWEAYICHHNHNSSHLRDCHYYTCHNNLVPLDIRVSQILLLVANVVGLVGTVCSVFALQQLYTEELHKNNDYNPFVLSAVLNAIASTFIFLAVMCNHLSVPSKEEVSFLQSFQMPIFSNAQRAGRAMGLAYISAILFLLSAIIFISYCPSMEIKMFPRV" misc_feature 231..728 /gene="Cldn34c2" /gene_synonym="EG625591; Gm6604" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
Gm16492; Gm513" /note="claudin 21, pseudogene; claudin 25, pseudogene" /codon_start=1 /product="putative claudin-25" /protein_id="NP_001371194.1" /db_xref="GeneID:100042785" /db_xref="MGI:MGI:3642767" /translation="MACSFRGRVQLGGLLLSVLGWVCSCVTTVLPQWKTLTLDLNEMETWVSGLWEACVNQEEAGTVCKAFESFLSLPQELQVARILMVASHGLGLLGLLLSSCGLECFRFHRPGGVFKTRLCLLGGTLEASASATTLFPVSWVAYATFQDFWDDSIPEIVPRWEFGDALFLGWAAGLFLAVGGLLLIFSACLENEDGSSSWMADATAPQACAPVEEEFDGSFHLTPRPVNQVI" misc_feature 124..597 /gene="Cldn25" /gene_synonym="Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_...
Synonym: Cldn21; Cldn21-ps; Cldn25-ps; Gm16492; Gm513
NM_001384265.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
musculus claudin 17 (Cldn17), mRNA. ACCESSION NM_181490 VERSION NM_181490.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK048287.1. On Apr 5, 2007 this sequence version replaced NM_181490.2. Summary: This gene encodes a member of the claudin family. Claudins are...
LOCUS XM_006528662 1107 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 34B1 (Cldn34b1), transcript variant X1, mRNA. ACCESSION XM_006528662 VERSION XM_006528662.4 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota...misc_feature 239..775 /gene="Cldn34b1" /gene_synonym="EG546400; Gm16390" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN //...
culus claudin 2 (Cldn2), transcript variant 1, mRNA. ACCESSION NM_016675 VERSION NM_016675.5 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced NM_016675.4. Summary: This gene encodes a member of the claudin family. Claudins are...
ulus claudin 9 (Cldn9), mRNA. ACCESSION NM_020293 VERSION NM_020293.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC154766.2. On Aug 6, 2010 this sequence version replaced NM_020293.2. Summary: This intronless gene encodes a member of the claudin family. Claudins...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL672243.12. On Aug 8, 2022 this sequence version replaced XM_006528490.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced XM_011240673.4. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced XM_030254750.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466554.1. On Dec 14, 2007 this sequence version replaced XM_001473536.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK036780.1 and CK626537.1. On Aug 3, 2010 this sequence version replaced NM_016674.3. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
LOCUS XM_011247720 493 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 34C2 (Cldn34c2), transcript variant X3, mRNA. ACCESSION XM_011247720 VERSION XM_011247720.3 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CH466633.1. On or before Oct 13, 2007 this sequence version replaced XM_904536.1, XM_888581.1. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
claudin 12 (Cldn12), transcript variant 4, mRNA. ACCESSION NM_001193661 VERSION NM_001193661.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193661.1. Summary: This gene encodes a member of the claudin family. Claudin...
claudin 12 (Cldn12), transcript variant 2, mRNA. ACCESSION NM_001193659 VERSION NM_001193659.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193659.1. Summary: This gene encodes a member of the claudin family. Claudin...
musculus claudin 10 (Cldn10), transcript variant a_v3, mRNA. ACCESSION NM_001160098 VERSION NM_001160098.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160098.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
culus claudin 10 (Cldn10), transcript variant a_v2, mRNA. ACCESSION NM_001160097 VERSION NM_001160097.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160097.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_022890.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
claudin 12 (Cldn12), transcript variant 3, mRNA. ACCESSION NM_001193660 VERSION NM_001193660.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AC068663.5. On Nov 22, 2023 this sequence version replaced NM_001193660.1. Summary: This gene encodes a member of the claudin family. Claudin...
musculus claudin 10 (Cldn10), transcript variant a_v1, mRNA. ACCESSION NM_001160096 VERSION NM_001160096.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, CA481582.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160096.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
LOCUS XM_011240674 3597 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 12 (Cldn12), transcript variant X4, mRNA. ACCESSION XM_011240674 VERSION XM_011240674.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Mus musculus claudin 10 (Cldn10), transcript variant b_v1, mRNA. ACCESSION NM_001160099 VERSION NM_001160099.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CK794879.1 and AI851016.1. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_001160099.1 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
LOCUS XM_036162108 3753 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 34C1 (Cldn34c1), transcript variant X4, mRNA. ACCESSION XM_036162108 VERSION XM_036162108.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
REFERENCE COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CA467408.1, AK020131.1, CK332009.1 and AI851016.1. On May 12, 2009 this sequence version replaced NM_023878.2. Summary: This intronless gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight unction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in...
Synonym: 6720456I16Rik; Cldn10a; Cldn10b; D14Ertd728e
NM_023878.3 -
Mus musculus (house mouse) -
NCBI -
UCSC -
RefEx(expression)
LOCUS XM_006503598 3799 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 12 (Cldn12), transcript variant X1, mRNA. ACCESSION XM_006503598 VERSION XM_006503598.5 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
LOCUS XM_036162106 3299 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 34C1 (Cldn34c1), transcript variant X2, mRNA. ACCESSION XM_036162106 VERSION XM_036162106.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
LOCUS XM_036162107 3227 bp mRNA linear ROD 10-APR-2023 DEFINITION PREDICTED: Mus musculus claudin 34C1 (Cldn34c1), transcript variant X3, mRNA. ACCESSION XM_036162107 VERSION XM_036162107.1 DBLINK BioProject: PRJNA169 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence...
Data Export:
Maximum 10000 results can be retrieved as Tab-delimited text or JSON format.
Debug Info:
Redirect URI : http://ggrna.dbcls.jp/mm/claudin
lang : en |
div : |
spe : mm |
query_string : claudin |
format : html |
download :
0.000 | 0.000 | search_start;
0.076 | 0.076 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=0&format=json
0.121 | 0.045 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:claudin)%7C(nt:claudin)%7C(aa:claudin))?source=Mus musculus (house mouse)?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.127 | 0.006 | cgi_end;
GGRNA ver.2 by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]