2025-09-16 18:29:36, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_071427011 1477 bp mRNA linear VRT 15-FEB-2025 DEFINITION PREDICTED: Agelaius tricolor Meis homeobox 2 (MEIS2), transcript variant X7, mRNA. ACCESSION XM_071427011 VERSION XM_071427011.1 DBLINK BioProject: PRJNA1221961 KEYWORDS RefSeq. SOURCE Agelaius tricolor (tricolored blackbird) ORGANISM Agelaius tricolor Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves; Passeriformes; Passeroidea; Icteridae; Agelaius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027269265) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_023055355.1-RS_2025_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/12/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1477 /organism="Agelaius tricolor" /mol_type="mRNA" /isolate="1412-34295" /db_xref="taxon:9191" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" /lat_lon="36.4692 N 121.7914 W" gene 1..1477 /gene="MEIS2" /note="Meis homeobox 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:139590012" CDS 431..1462 /gene="MEIS2" /codon_start=1 /product="homeobox protein Meis2 isoform X7" /protein_id="XP_071283112.1" /db_xref="GeneID:139590012" /translation="
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHAGQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWCVYAPGLLATVHSIYRS"
misc_feature 758..1012 /gene="MEIS2" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature 1313..>1408 /gene="MEIS2" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
gcccggggccgcaccggctccgcgcgccccccccgcgcgctgtagctcccggtgcccggggctcgcgcaccgcgcgcggcagcggccggagccgccgacccgagccagcggccccgcgcgccgccagacgccccacgccgcgggtaatcggaagagaaagaaaaaaagaaaaagagagacagaaaaaggaaagagaaagagacagaaaaaaagaagaaaacagaaactcatcgtggttcttgactgttttttatatattgttgttgttattgttgttgttattactattatttacccatattggaggataggagaagtctataagtgggttgcaaaaaaaaaggaatcttcttcactctaaatcactttctttgctggactgggatattaaatatacgacacatccaggagtttattggagcgcagactgatggcgcaaaggtacgatgagctgccccactacggcgggatggacggagtaggggtgccggcgtccatgtacggggacccccacgccccccggccgatccccccggtgcaccacctcaaccatgggccgccgctccacgccggacagcactacggcgcccacgccccgcaccccaatgtcatgccggccagcatgggctccgctgtcaacgacgccctgaaacgggacaaggatgcgatctacgggcacccgttgttccccctcttagctctggtctttgagaagtgcgagctggcgacctgcacgccccgggagcccggcgtggccggcggggacgtctgctcctccgactccttcaacgaggacatcgccgtcttcgctaaacaggtccgcgccgaaaagccacttttttcgtcaaatccagagttggacaatttgatgatccaagcaatacaagtactaaggtttcatcttttggaattagaaaaggttcatgaattgtgtgataatttctgccatcggtacattagttgtttgaaaggaaaaatgccaatagacctcgttattgatgaaagggatggcagctccaaatcagaccatgaagaactctcaggatcttccacaaatttagccgatcataatccttcatcttggagagaccacgatgatgcaacctcaacgcactcggcaggcacaccagggccctccagcgggggccacgcttcccagagtggagacaacagcagcgagcaaggtgatggtttagacaacagtgtagcctcacctggtacaggagatgatgatgacccagacaaggacaaaaagcgtcagaagaaaagaggcattttccccaaagtagcaacaaatatcatgagagcgtggcttttccagcatctcacacatccatatccttcagaggagcagaagaaacagttagcccaagacacgggacttacaattctacaagtaaacaactggtgtgtttatgccccaggcttgctggccacagtccattccatttacagaagctgaattaaacaataacta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]