2025-09-16 18:36:51, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_055079091 1074 bp mRNA linear MAM 10-JAN-2025 DEFINITION PREDICTED: Physeter macrocephalus Meis homeobox 3 (MEIS3), transcript variant X11, mRNA. ACCESSION XM_055079091 VERSION XM_055079091.1 DBLINK BioProject: PRJNA434122 KEYWORDS RefSeq. SOURCE Physeter macrocephalus (sperm whale) ORGANISM Physeter macrocephalus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Physeteridae; Physeter. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_041230.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_002837175.3-RS_2025_01 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 01/08/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1074 /organism="Physeter macrocephalus" /mol_type="mRNA" /isolate="SW-GA" /db_xref="taxon:9755" /chromosome="17" /sex="female" /tissue_type="muscle" /dev_stage="adult" gene 1..1074 /gene="MEIS3" /note="Meis homeobox 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:102992440" CDS 1..990 /gene="MEIS3" /codon_start=1 /product="homeobox protein Meis3 isoform X11" /protein_id="XP_054935066.1" /db_xref="GeneID:102992440" /translation="
MGHRGPKGARLGHLGTVGQYDELPHYPGIVDSTAALAGFSEAVPSAPRAPGPYGPHRPPQPPPLGLDSDGLRREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGTGLGTPPGSDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCKEDLDGYPASCPSLPDQNTVWIRDQEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTNVASPSSGGEDEELDQERRKNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLSQDTGLTILQVNN"
misc_feature 340..594 /gene="MEIS3" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature 895..>987 /gene="MEIS3" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
atgggacatcgggggcctaagggagcaaggctgggacacttggggacagtggggcagtacgatgagctgccccactaccccggcatcgtggacagcactgcagccctggctggcttctcggaggcagtgccctcggcaccgagagcccccgggccctacggcccccaccggcctccccagcccccgcccctgggcttggatagtgatggcctgaggagggagaaggatgagatctacggacacccgctcttccctctgctggccctggtctttgagaaatgtgaattggccacgtgttctccccgtgatggggctgggactgggctgggcacacccccaggcagtgacgtatgctcctccgattccttcaatgaggacattgcagcctttgccaagcaggtccgctccgagaggcctctcttctcctccaacccggagctggacaatctgatgatacaggccattcaagtgctccgcttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcaccgctacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatagggacggcggctgcaaggaggatctcgatggctacccggcctcctgcccgagcctcccagatcagaatacagtatggattagagaccaggaagacagcgggtctgtacatttggggaccccgggtccatccagcgggggcctggcctcccagagtggtgacaactccagtgaccagggagatggactagacacaaatgtggcctctcccagttctgggggagaggacgaggagctggaccaggaacggcggaaaaacaagaagagagggatcttccccaaggtggccaccaacatcatgagagcctggctgttccagcacctctcgcacccgtacccctcagaggaacagaagaaacagctgtcgcaggacacggggctcaccatcctacaagtcaacaactgaccccaacctctggactgtgacagccaggctcatacccgcttctggtcgacgcctggccctctggcttcaggaccccacctccta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]