GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-16 20:29:37, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_022082531             819 bp    mRNA    linear   INV 06-AUG-2017
DEFINITION  PREDICTED: Zootermopsis nevadensis protein argonaute-1-like
            (LOC110838885), mRNA.
ACCESSION   XM_022082531
VERSION     XM_022082531.1
DBLINK      BioProject: PRJNA396924
KEYWORDS    RefSeq.
SOURCE      Zootermopsis nevadensis
  ORGANISM  Zootermopsis nevadensis
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Polyneoptera; Dictyoptera; Blattodea;
            Blattoidea; Termitoidae; Termopsidae; Zootermopsis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_019060616.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Zootermopsis nevadensis Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..819
                     /organism="Zootermopsis nevadensis"
                     /mol_type="mRNA"
                     /db_xref="taxon:136037"
                     /chromosome="Unknown"
                     /tissue_type="whole organism"
                     /note="a mixed sample from a naturally inbred family that
                     contains both sexes"
     gene            1..819
                     /gene="LOC110838885"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 27 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:110838885"
     CDS             82..414
                     /gene="LOC110838885"
                     /codon_start=1
                     /product="protein argonaute-1-like"
                     /protein_id="XP_021938223.1"
                     /db_xref="GeneID:110838885"
                     /translation="
MEICNLSSEDLHRELSKERKRDFMNYILGLNVDYMLPNVPTSKRTCKVNRVVENAVKQMFELDSGRSISVAEYIAQEKKIRLSYPHLLCLHVGSLNRCSPIYAPAEVSKA"
     misc_feature    <238..402
                     /gene="LOC110838885"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(259..261,289..291,301..303,355..357,382..384,
                     388..390)
                     /gene="LOC110838885"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
tacttaatgtaactggaatgtttttgtttcacagtggtacacaaaggtttttcttcaccaaaaaatgttgttgatattcttatggagatatgcaacctcagtagtgaagaccttcatcgagaattgtcaaaggagcggaagagagattttatgaactatattcttggccttaacgttgattatatgcttccaaatgtgccaacaagcaagagaacatgcaaagtgaacagagttgttgaaaatgcagttaaacagatgtttgagttggatagtggcagatcaatatcagttgcagaatacattgcccaagagaagaagatacggctttcatatcctcatctcctatgtcttcatgttggctcactgaataggtgcagtccaatttatgctccagcggaagtaagtaaagcatagttattttcgtatcatagtgttaatatgcactgttgctagtcaccattagcatccaaaagtatttggctggtaagtaactttttgccatttttatttaattttagccttctttccttgctttatatgaaccagcttgatcagtcattatagtgattatgctgtggggtggatgattgaggttgagtttggctggctgattaattatttttcatgatattcctcagtcttttaaggtgaatgccagagaagtgttatgaagcagggaagactgcttttttgttaatcattatgtaatcattctttatggttactttgtcctttcattttatttagtctccacctaacttcctcatgaggaagttaggaggagactaaattccagaaatgcttgctacttctcagttc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]