2025-09-16 20:29:37, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_022082531 819 bp mRNA linear INV 06-AUG-2017 DEFINITION PREDICTED: Zootermopsis nevadensis protein argonaute-1-like (LOC110838885), mRNA. ACCESSION XM_022082531 VERSION XM_022082531.1 DBLINK BioProject: PRJNA396924 KEYWORDS RefSeq. SOURCE Zootermopsis nevadensis ORGANISM Zootermopsis nevadensis Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Polyneoptera; Dictyoptera; Blattodea; Blattoidea; Termitoidae; Termopsidae; Zootermopsis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_019060616.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Zootermopsis nevadensis Annotation Release 100 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 7.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..819 /organism="Zootermopsis nevadensis" /mol_type="mRNA" /db_xref="taxon:136037" /chromosome="Unknown" /tissue_type="whole organism" /note="a mixed sample from a naturally inbred family that contains both sexes" gene 1..819 /gene="LOC110838885" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:110838885" CDS 82..414 /gene="LOC110838885" /codon_start=1 /product="protein argonaute-1-like" /protein_id="XP_021938223.1" /db_xref="GeneID:110838885" /translation="
MEICNLSSEDLHRELSKERKRDFMNYILGLNVDYMLPNVPTSKRTCKVNRVVENAVKQMFELDSGRSISVAEYIAQEKKIRLSYPHLLCLHVGSLNRCSPIYAPAEVSKA"
misc_feature <238..402 /gene="LOC110838885" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(259..261,289..291,301..303,355..357,382..384, 388..390) /gene="LOC110838885" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" ORIGIN
tacttaatgtaactggaatgtttttgtttcacagtggtacacaaaggtttttcttcaccaaaaaatgttgttgatattcttatggagatatgcaacctcagtagtgaagaccttcatcgagaattgtcaaaggagcggaagagagattttatgaactatattcttggccttaacgttgattatatgcttccaaatgtgccaacaagcaagagaacatgcaaagtgaacagagttgttgaaaatgcagttaaacagatgtttgagttggatagtggcagatcaatatcagttgcagaatacattgcccaagagaagaagatacggctttcatatcctcatctcctatgtcttcatgttggctcactgaataggtgcagtccaatttatgctccagcggaagtaagtaaagcatagttattttcgtatcatagtgttaatatgcactgttgctagtcaccattagcatccaaaagtatttggctggtaagtaactttttgccatttttatttaattttagccttctttccttgctttatatgaaccagcttgatcagtcattatagtgattatgctgtggggtggatgattgaggttgagtttggctggctgattaattatttttcatgatattcctcagtcttttaaggtgaatgccagagaagtgttatgaagcagggaagactgcttttttgttaatcattatgtaatcattctttatggttactttgtcctttcattttatttagtctccacctaacttcctcatgaggaagttaggaggagactaaattccagaaatgcttgctacttctcagttc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]