2025-09-16 22:12:31, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_020597641 3372 bp mRNA linear VRT 12-JUN-2025 DEFINITION PREDICTED: Monopterus albus argonaute RISC component 4 (ago4), mRNA. ACCESSION XM_020597641 VERSION XM_020597641.1 DBLINK BioProject: PRJNA380265 KEYWORDS RefSeq. SOURCE Monopterus albus (swamp eel) ORGANISM Monopterus albus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Anabantaria; Synbranchiformes; Synbranchidae; Monopterus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_018127914.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_001952655.1-RS_2025_06 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.4 Annotation Method :: Best-placed RefSeq; Gnomon; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 06/12/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..3372 /organism="Monopterus albus" /mol_type="mRNA" /db_xref="taxon:43700" /chromosome="Unknown" /sex="male" /geo_loc_name="China" gene 1..3372 /gene="ago4" /note="argonaute RISC component 4; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:109958748" CDS 275..2866 /gene="ago4" /codon_start=1 /product="protein argonaute-4" /protein_id="XP_020453297.1" /db_xref="GeneID:109958748" /translation="
MEALGPGPPAPTSLFQPPRRPGLGTVGKPIRLLANHFQVQIPKIDVYHYDIDIKPEKRPRRVNREVVDTMVRHFKMQIFGDRQPGYDGKRNMYTAHPLPIGRDRVDLEVTLPGEGKDQTFKVSLQWVSVVSLQMLLEALSGHLNEVPEDSVQALDVITRHLPSMRYTPVGRSFFSPPEGYYHPLGGGREVWFGFHQSVRPAMWNMMLNIDVSATAFYRAQPVIEFMCEVLDIQNINEQTKPLTDSQRVKFTKEIRGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLENGQAMECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIKATARSAPDRQEEISRLVSAXSMVGGPDPYLKEFGIVVHNDMTEVTGRVLPAPMLQYGGRNKTVATPNQGVWDMRGKQFYAGIEIKVWAVACFAPQKQCREDLLKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFKHLKMSYVGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVKTSPQTLSNLCLKINAKLGGINNVLVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDGHPSRYCATVRVQTSRQDMSQEQLFSQEVIQDLTNMVRELLIQFYKSTRFKPTRIIYYRGGVSEGQMKQVAWPELIAIRKACISLEEDYRPGITYIVVQKRHHTRLFCSDKAERVGKSGNVPAGTTVDSTITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTADELQLLTYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKDHDSAEGSHVSGQSNGRDPQALAKAVQIHYDTQHTMYFA"
misc_feature 356..745 /gene="ago4" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:465134" misc_feature 776..928 /gene="ago4" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:462567" misc_feature 929..1291 /gene="ago4" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(1085..1087,1130..1132,1172..1174,1184..1186, 1238..1240,1259..1261,1265..1267) /gene="ago4" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1430..2737 /gene="ago4" /note="PIWI domain, Argonaute-like subfamily. Argonaute is the central component of the RNA-induced silencing complex (RISC) and related complexes. The PIWI domain is the C-terminal portion of Argonaute and consists of two subdomains, one of which provides the...; Region: Piwi_ago-like; cd04657" /db_xref="CDD:240015" misc_feature order(1841..1843,1853..1855,1889..1900,1907..1909, 1931..1933,1940..1942,1952..1954,1964..1966) /gene="ago4" /note="5' RNA guide strand anchoring site [active]" /db_xref="CDD:240015" misc_feature order(2045..2047,2051..2053,2291..2293,2705..2707) /gene="ago4" /note="active site" /db_xref="CDD:240015" ORIGIN
atatattggtcttcactcacagtgcggcacagcaaattacgcatgcgcacagcgagctccacgtctaaccggcgcatgcgctctttcaaaccctcagaaccagcaaacaacggcagtagctcaggtcagtcggtccagtcagtaggcatccacgcgtctatctatattcccttttcttaaattagtcactttaagcttcgcgataccgcccccaatttcagtgtcggtacggagccgccaggccgggacagagacggagagagaggcctcggccatggaagcgctcggacccggcccgcctgcccctacctctctgtttcagcctccgcggcgtcctggcctcggcacagtggggaaacccatccggctccttgccaaccacttccaggtgcagattcccaagattgatgtctatcactatgatatcgacatcaagcctgagaaacggcctcggagggtcaacagggaggtggtggacaccatggtgcggcacttcaagatgcagatctttggagaccgacagcctggctacgatgggaagaggaacatgtacacagcacatccactgccaatagggagagacagggtggatttggaggtgaccctgcctggcgaggggaaggatcagacgttcaaagtgtctttgcagtgggtgtctgtggtcagtcttcagatgctgctggaagccctgtcaggtcacctcaacgaggtaccagaggactccgtgcaggctctagatgtcatcacacggcatctgccttccatgaggtacactccagtggggcgttcatttttctcccccccagagggctattaccatcctcttggtggaggcagagaggtgtggtttggtttccatcagtctgtgcgtcctgccatgtggaacatgatgctcaacattgatgtgtcagccactgctttctaccgtgctcagcctgtgatagagttcatgtgtgaggtgcttgatatacagaacatcaacgaacagaccaaaccactgactgactctcagcgcgtcaaattcaccaaggaaataagaggcttgaaagttgaggtgacacactgtggacagatgaagaggaagtatcgtgtgtgcaatgtcacgcgtcgacctgccagccaccaaacgttccccttacagcttgagaatggccaagccatggagtgcacagtagctcagtatttcaagcaaaagtacaacctgcagctcaagtatccacatttaccctgtttacaagtagggcaggagcagaagcacacctaccttcccctggaggtctgtaacatagtggcaggccagcgctgtatcaaaaaactgactgacaaccagacatccaccatgattaaagctacagctcgctctgcccccgacagacaggaagagatcagcagactggtgagtgcnnnnagcatggttgggggcccagacccttacctgaaggaatttggcattgttgtgcacaatgacatgacagaggtgacggggcgtgtcctcccagcgcccatgctacagtatgggggccggaataaaacggtggccacgcccaaccagggcgtgtgggacatgagagggaagcagttctacgctggcatcgagatcaaggtctgggctgtggcctgctttgccccacagaaacagtgccgggaggacctgctcaagagtttcactgaccaactgcgaaagatctccaaggatgctggcatgcctattcagggccagccatgtttctgtaaatacgcccaaggagctgacagtgtggagcctatgttcaaacacctcaaaatgtcttatgtaggtctgcagctgattgtcgtcatcctgcctggcaaaacaccggtctatgctgaagtgaagcgggtaggtgacaccctcctcggcatggccactcagtgtgtgcaggtgaagaacgtggtgaagacgtccccacaaaccctctccaacctctgcctcaagatcaacgccaagctgggaggcatcaacaacgtcctggtgcctcatcaacggccatctgtgttccagcagccggtcatcttcctgggcgctgatgtgacacaccctccagcaggtgatgggaagaagccgtccattgcggcagtggtgggcagcatggatggccaccccagccgctactgtgcgacagtacgagtccagacatctcgacaagacatgtcccaggagcagctgttcagccaggaggtaatccaagacttgacgaacatggtgcgtgagttgctcatccagttctacaagtctacacgcttcaagcccacacgcatcatctactatcgtggtggtgtttctgagggacaaatgaaacaggtggcatggccggagctgatagccatccggaaggcatgtatcagtctggaggaggattacaggcctggtattacctacattgtggtccagaaacgtcaccacactcggctgttctgctctgataaagctgagagggtggggaagagtggtaatgtcccagctggcaccacagtggacagcaccatcacgcacccgtccgagtttgacttctatctgtgcagccatgctgggattcagggaaccagtcgtccctcccactaccacgtcctgtgggatgacaactgtttcacagcggatgaactgcagcttctcacctaccagctgtgccacacctatgtccgctgcacacgctctgtttccattccagcaccagcctattacgccaggctagtggcttttcgagcccgctaccacctggtggacaaagaccatgacagtgctgaaggcagccatgtgtcgggccagagtaacggccgggacccacaagcattggccaaggcagttcagatccactatgatacccagcacaccatgtactttgcctgagctagcaagcacatcagccagtcaacctatggattccctttctttctgtctttttatctatttaccagtttctcctcttcagtgtctctctgcctccttgtagtctttctcctcgttctcactctacatttctgaatctgcaccaaaggggctcttggacaggagagtctgcggtaactcggatgtccagcaggttcttttttatggaacaatctccaaccagcgttcccagtcgagccaccttcctaaccagcgatccgccactgtgaaccctgatggttctcagtgcacaaaagaaaaaaaaacttgaaaaaacaaaaacaaaccacacacatacaagttgagccattattttgagtttgtttttgttttttctgtttgaatgtctgcactcttgtgtttaagatacactgagcgagggagtggattggcacagtctgtgtcagcgcagctctttagctctcccagctaagcaggactcttatctacttttacctcaaagccct
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]